KEGG   Pongo abelii (Sumatran orangutan): 100431324
Entry
100431324         CDS       T01416                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100431324
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100431324
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100431324
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100431324
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 100431324
NCBI-ProteinID: XP_002826409
LinkDB
Position
16
AA seq 203 aa
MSCPLARLCLLTLLSPPLSSAASISPPEPISQAYRLALYMQKNTSMLLWTYLQYQGSPFS
DPGFSAPELQLSSLPPATAFFKTWHALDDGERLSLAQRAFLALTQHLQLVGDDQSDLNPG
SPILLAQLGAARLRAQGLLGSMATSMTALGLPIPPEEDTLGLVAFGASAFERKCRGYMVT
REYGHWTDRAVRDLALLKAKYPA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagctgtccactggcccgcctctgcctgctgaccctgctgtcgccacccctcagctca
gcagcctccatctccccgcctgagcccatcagtcaagcctatagactggccctctacatg
cagaagaacacctcaatgctgctgtggacttacctccagtaccagggcagcccctttagt
gaccctggcttctcggcccctgagctccagctcagcagcctgcctcctgccactgccttc
tttaagacctggcacgccctggatgatggggaacggctgagccttgcccagagggccttc
ctggcattgacccagcacctccagctcgtgggggatgaccagagcgacctgaaccctggc
agtcccatcctgctggctcagctcggggctgcgagactcagggcccaaggcctgctgggc
agtatggccaccagcatgacggccctggggctgccaatccccccagaagaggatactcta
gggcttgttgcctttggggcctcggcctttgagaggaaatgtcgaggctacatggtgacc
cgggaatatggccactggacagaccgagctgtgagagacttggctctgctcaaggctaag
tacccagcatag

KEGG   Pongo abelii (Sumatran orangutan): 100431405
Entry
100431405         CDS       T01416                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04622  RIG-I-like receptor signaling pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100431405 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100431405 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100431405 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100431405 (IFNE)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100431405 (IFNE)
SSDB
Motif
Pfam: Interferon DUF1027 Poxvirus_B22R_N
Other DBs
NCBI-GeneID: 100431405
NCBI-ProteinID: XP_009242660
LinkDB
Position
9
AA seq 193 aa
MIIKHFFGIVLVLLASTTIFSVDLKLIIFQQRQVNQESLKLLNKLQTSSIQQCLPHRKNF
LLPQKSLSPQQYQKRHTLAILHEMLQQIFSLFRANISLDGWEENHMEKFLIQLHQQLEYL
EALMGLEAEKLSGTLGSDNLTLQVKMYFRRICDYLENQDYSSCAWAIVQVEINRCLFFVF
SLTEKLSKQGTDP
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattatcaagcacttctttggaattgtgttggtgctgctggcctctaccactatcttc
tctgtagatttgaaactgattatcttccagcaaagacaagtgaatcaagaaagtttaaaa
ctcttgaataagttgcaaacctcatcaattcagcagtgtctaccacacaggaaaaacttt
ctgcttcctcagaagtctttgagtcctcagcagtaccaaaaaagacacactctggccatt
ctccatgagatgcttcagcagatcttcagcctcttcagggcaaatatttctctggatggt
tgggaggaaaaccacatggagaaattcctcattcaacttcatcaacagctagaataccta
gaagcactcatgggactggaagcagagaagctaagtggtactttgggtagtgataacctt
acattacaagttaaaatgtacttccgaaggatctgtgattacctggaaaaccaggactac
agcagctgtgcctgggccattgtccaagtagaaatcaaccggtgtctgttctttgtgttc
agtctcacagaaaaactgagcaaacaaggaacagacccttga

KEGG   Pongo abelii (Sumatran orangutan): 100432153
Entry
100432153         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-1/13
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100432153
   04151 PI3K-Akt signaling pathway
    100432153
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100432153
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100432153
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100432153
   04621 NOD-like receptor signaling pathway
    100432153
   04622 RIG-I-like receptor signaling pathway
    100432153
   04623 Cytosolic DNA-sensing pathway
    100432153
   04650 Natural killer cell mediated cytotoxicity
    100432153
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432153
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100432153
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100432153
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100432153
   05161 Hepatitis B
    100432153
   05160 Hepatitis C
    100432153
   05171 Coronavirus disease - COVID-19
    100432153
   05164 Influenza A
    100432153
   05162 Measles
    100432153
   05168 Herpes simplex virus 1 infection
    100432153
   05163 Human cytomegalovirus infection
    100432153
   05167 Kaposi sarcoma-associated herpesvirus infection
    100432153
   05169 Epstein-Barr virus infection
    100432153
   05165 Human papillomavirus infection
    100432153
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100432153
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100432153
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 100432153
NCBI-ProteinID: XP_002819786
UniProt: A0A2J8XIS4
LinkDB
Position
9
AA seq 189 aa
MASPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRLDFG
FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDEFCTELYQQLNDLE
ACVMQEERVGETPLINADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcctcaccctttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctgcctgagacccacagcctggataacaggaggaccttgatgctc
ctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacttgactttgga
tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgcttgg
gatgaggacctcctagacgaattctgcactgaactctaccagcagctgaatgacttggaa
gcctgtgtgatgcaggaggagagggtgggagaaactcccctgataaatgcggactccatc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaattatgagatccctctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Pongo abelii (Sumatran orangutan): 100432532
Entry
100432532         CDS       T01416                                 

Gene name
IFNA8
Definition
(RefSeq) interferon alpha-8
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100432532 (IFNA8)
   04151 PI3K-Akt signaling pathway
    100432532 (IFNA8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100432532 (IFNA8)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100432532 (IFNA8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100432532 (IFNA8)
   04621 NOD-like receptor signaling pathway
    100432532 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    100432532 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    100432532 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    100432532 (IFNA8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432532 (IFNA8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100432532 (IFNA8)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100432532 (IFNA8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100432532 (IFNA8)
   05161 Hepatitis B
    100432532 (IFNA8)
   05160 Hepatitis C
    100432532 (IFNA8)
   05171 Coronavirus disease - COVID-19
    100432532 (IFNA8)
   05164 Influenza A
    100432532 (IFNA8)
   05162 Measles
    100432532 (IFNA8)
   05168 Herpes simplex virus 1 infection
    100432532 (IFNA8)
   05163 Human cytomegalovirus infection
    100432532 (IFNA8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100432532 (IFNA8)
   05169 Epstein-Barr virus infection
    100432532 (IFNA8)
   05165 Human papillomavirus infection
    100432532 (IFNA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100432532 (IFNA8)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100432532 (IFNA8)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100432532
NCBI-ProteinID: XP_002819787
Ensembl: ENSPPYG00000019174
UniProt: H2PS16
LinkDB
Position
9
AA seq 189 aa
MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALVLLAQMKRISPFSCLKDRRDFG
FPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKNSSAALDETLLDEFYIELDQQLNNLE
SCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLAEKKYSSCAWEVVRAEIMRSFSLSIN
LQKRLKSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgactttttatttactggtggccctagtggtgctcagctacaagtcattcagc
tctctgggctgtgatctgcctcagactcacagcctgggtaacaggagggccttggtgctc
ctggcacaaatgaaaagaatctctcctttctcctgcctgaaggacagacgtgactttgga
ttcccccaggaggagtttgatgataaacagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaacctcttcagcacaaagaattcatctgctgctttg
gatgagacccttctagatgaattctacatcgaacttgaccagcagctgaataacctggag
tcctgtgtgatgcaggaagtgggggtgatagagtctcccctcatgtacgaggactccatc
ttggctgtgaggaaatacttccaaagaatcactctatatctggcagagaagaaatacagc
tcttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac
ttgcaaaaaagattgaagagtaaggaatga

KEGG   Pongo abelii (Sumatran orangutan): 100432906
Entry
100432906         CDS       T01416                                 

Gene name
IFNA2
Definition
(RefSeq) interferon alpha-2
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100432906 (IFNA2)
   04151 PI3K-Akt signaling pathway
    100432906 (IFNA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100432906 (IFNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100432906 (IFNA2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100432906 (IFNA2)
   04621 NOD-like receptor signaling pathway
    100432906 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    100432906 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    100432906 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    100432906 (IFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432906 (IFNA2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100432906 (IFNA2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100432906 (IFNA2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100432906 (IFNA2)
   05161 Hepatitis B
    100432906 (IFNA2)
   05160 Hepatitis C
    100432906 (IFNA2)
   05171 Coronavirus disease - COVID-19
    100432906 (IFNA2)
   05164 Influenza A
    100432906 (IFNA2)
   05162 Measles
    100432906 (IFNA2)
   05168 Herpes simplex virus 1 infection
    100432906 (IFNA2)
   05163 Human cytomegalovirus infection
    100432906 (IFNA2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100432906 (IFNA2)
   05169 Epstein-Barr virus infection
    100432906 (IFNA2)
   05165 Human papillomavirus infection
    100432906 (IFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100432906 (IFNA2)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100432906 (IFNA2)
SSDB
Motif
Pfam: Interferon CBF APC1_C DDHD
Other DBs
NCBI-GeneID: 100432906
NCBI-ProteinID: XP_002819788
Ensembl: ENSPPYG00000019175
UniProt: A0A663DA02 H2PS17
LinkDB
Position
9
AA seq 188 aa
MALTFALLVTLLVLSCKSSCSLGCDLPQTHSLGNRRTLMLLAQMRRLSLFSCLKDRHDFG
FPQEEFGNQFQKAQTIPVLHEMIQQIFNLFSTKDSCAAWDETLLDKFYTELYQQLNDLED
CVMQEVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVREEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtgaccctcctggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctgcctcaaacccacagcctgggtaacaggaggaccttgatgctc
ctggcacaaatgaggagactctctcttttctcctgcttgaaggacagacatgactttgga
tttccccaggaggagtttggcaaccagttccaaaaggctcaaaccatccctgtcctccat
gagatgatccagcagatcttcaatctcttcagcacaaaggactcatgtgctgcttgggat
gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagac
tgtgtgatgcaggaggtgggggtgacagagactcccctgatgaaggaggactccattctg
gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct
tgtgcctgggaggttgtcagagaagaaatcatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

KEGG   Pongo abelii (Sumatran orangutan): 100433301
Entry
100433301         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-1/13-like
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100433301
   04151 PI3K-Akt signaling pathway
    100433301
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100433301
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100433301
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100433301
   04621 NOD-like receptor signaling pathway
    100433301
   04622 RIG-I-like receptor signaling pathway
    100433301
   04623 Cytosolic DNA-sensing pathway
    100433301
   04650 Natural killer cell mediated cytotoxicity
    100433301
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433301
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100433301
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100433301
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100433301
   05161 Hepatitis B
    100433301
   05160 Hepatitis C
    100433301
   05171 Coronavirus disease - COVID-19
    100433301
   05164 Influenza A
    100433301
   05162 Measles
    100433301
   05168 Herpes simplex virus 1 infection
    100433301
   05163 Human cytomegalovirus infection
    100433301
   05167 Kaposi sarcoma-associated herpesvirus infection
    100433301
   05169 Epstein-Barr virus infection
    100433301
   05165 Human papillomavirus infection
    100433301
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100433301
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100433301
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100433301
NCBI-ProteinID: XP_002819789
Ensembl: ENSPPYG00000019176
UniProt: A0A663D6T6 H2PS18
LinkDB
Position
9
AA seq 189 aa
MALPFALLMALVVLSCKSSCSLGCDLPETHNLDNRRTLMLLTQRSRISPSSCLMDRHDFV
FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDEFCTELYQQLNDLE
ACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctgcctgagacccacaacctggataacaggaggaccttgatgctc
ctgacacaaaggagcagaatctctccttcctcctgtctgatggacagacatgactttgta
tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgcttgg
gatgaggacctcctagacgaattctgcactgaactctaccagcagctgaatgacttggaa
gcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactccatc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Pongo abelii (Sumatran orangutan): 100434036
Entry
100434036         CDS       T01416                                 

Gene name
IFNA6
Definition
(RefSeq) interferon alpha-6
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100434036 (IFNA6)
   04151 PI3K-Akt signaling pathway
    100434036 (IFNA6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100434036 (IFNA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100434036 (IFNA6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100434036 (IFNA6)
   04621 NOD-like receptor signaling pathway
    100434036 (IFNA6)
   04622 RIG-I-like receptor signaling pathway
    100434036 (IFNA6)
   04623 Cytosolic DNA-sensing pathway
    100434036 (IFNA6)
   04650 Natural killer cell mediated cytotoxicity
    100434036 (IFNA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100434036 (IFNA6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100434036 (IFNA6)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100434036 (IFNA6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100434036 (IFNA6)
   05161 Hepatitis B
    100434036 (IFNA6)
   05160 Hepatitis C
    100434036 (IFNA6)
   05171 Coronavirus disease - COVID-19
    100434036 (IFNA6)
   05164 Influenza A
    100434036 (IFNA6)
   05162 Measles
    100434036 (IFNA6)
   05168 Herpes simplex virus 1 infection
    100434036 (IFNA6)
   05163 Human cytomegalovirus infection
    100434036 (IFNA6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100434036 (IFNA6)
   05169 Epstein-Barr virus infection
    100434036 (IFNA6)
   05165 Human papillomavirus infection
    100434036 (IFNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100434036 (IFNA6)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100434036 (IFNA6)
SSDB
Motif
Pfam: Interferon MAS20
Other DBs
NCBI-GeneID: 100434036
NCBI-ProteinID: XP_002819791
Ensembl: ENSPPYG00000019178
UniProt: H2PS20
LinkDB
Position
9
AA seq 189 aa
MALPFALLMALVVLSCKSSCSLGCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFR
FPQEEFDGNQFQKAEAISVLYEVIQQTFNLFSTKDSSAAWDERLLDKLYTELYQQLNDLE
ACVMQEVLVGETPLKNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN
LQERLRMKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctttgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctgcctcagacccacagcctgggtcacaggaggaccatgatgctc
ctggcacaaatgaggagaatctctcttttctcctgtctgaaggacagacacgacttcaga
tttccccaggaggagtttgatggcaaccagttccagaaggctgaagccatctctgtcctc
tatgaggttatccagcagaccttcaacctcttcagcacaaaggactcatctgctgcttgg
gatgagaggcttctagacaaactctacactgaactttaccagcagctgaatgacctggaa
gcttgtgtgatgcaggaggtgttggtgggagagactcccctgaagaatgaagactccatc
ctggctgtgagaaaatacttccaaagaatcactctctacctgacagagaagaagtacagc
ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctcttcatcaagaaac
ttgcaagaaagattaaggatgaaggaataa

KEGG   Pongo abelii (Sumatran orangutan): 100434796
Entry
100434796         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-5
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100434796
   04151 PI3K-Akt signaling pathway
    100434796
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100434796
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100434796
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100434796
   04621 NOD-like receptor signaling pathway
    100434796
   04622 RIG-I-like receptor signaling pathway
    100434796
   04623 Cytosolic DNA-sensing pathway
    100434796
   04650 Natural killer cell mediated cytotoxicity
    100434796
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100434796
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100434796
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100434796
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100434796
   05161 Hepatitis B
    100434796
   05160 Hepatitis C
    100434796
   05171 Coronavirus disease - COVID-19
    100434796
   05164 Influenza A
    100434796
   05162 Measles
    100434796
   05168 Herpes simplex virus 1 infection
    100434796
   05163 Human cytomegalovirus infection
    100434796
   05167 Kaposi sarcoma-associated herpesvirus infection
    100434796
   05169 Epstein-Barr virus infection
    100434796
   05165 Human papillomavirus infection
    100434796
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100434796
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100434796
SSDB
Motif
Pfam: Interferon CBF APC1_C
Other DBs
NCBI-GeneID: 100434796
NCBI-ProteinID: XP_002819793
Ensembl: ENSPPYG00000019180
UniProt: H2PS22
LinkDB
Position
9
AA seq 189 aa
MALPFALLMALMVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLLEMIQQTFNLFSTKDSSGTWDETLLDKFYTELYQQLNDLE
ACMMQEVGAEDTPLMNVDSILAVRKYFQRITLYLAEKKYSPCAWEVVRAEIMRSFSLSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttgctttactgatggccctgatggtgctcaactgcaagtcaatctgt
tctctcggctgtgatctgcctcagactcacagcctgagtaataggaggactttgatgatc
atggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
tttcctcaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctt
cttgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctggtacttgg
gatgagacacttctagacaaattctacactgaactttaccagcagctgaatgacctggaa
gcctgtatgatgcaggaggttggagcggaagacactcctctgatgaatgtggactctatc
ctggctgtgagaaaatactttcaaagaatcactctctatctggcagagaagaaatacagc
ccttgtgcatgggaggttgttagagcagaaatcatgagatccttctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaatga

KEGG   Pongo abelii (Sumatran orangutan): 100435169
Entry
100435169         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-14
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100435169
   04151 PI3K-Akt signaling pathway
    100435169
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100435169
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100435169
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100435169
   04621 NOD-like receptor signaling pathway
    100435169
   04622 RIG-I-like receptor signaling pathway
    100435169
   04623 Cytosolic DNA-sensing pathway
    100435169
   04650 Natural killer cell mediated cytotoxicity
    100435169
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100435169
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100435169
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100435169
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100435169
   05161 Hepatitis B
    100435169
   05160 Hepatitis C
    100435169
   05171 Coronavirus disease - COVID-19
    100435169
   05164 Influenza A
    100435169
   05162 Measles
    100435169
   05168 Herpes simplex virus 1 infection
    100435169
   05163 Human cytomegalovirus infection
    100435169
   05167 Kaposi sarcoma-associated herpesvirus infection
    100435169
   05169 Epstein-Barr virus infection
    100435169
   05165 Human papillomavirus infection
    100435169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100435169
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100435169
SSDB
Motif
Pfam: Interferon APC1_C DDHD CoV_NSP2_N
Other DBs
NCBI-GeneID: 100435169
NCBI-ProteinID: XP_002819794
Ensembl: ENSPPYG00000019181
UniProt: A0A6D2WFG4 H2PS23
LinkDB
Position
9
AA seq 189 aa
MALPFALMMALVVLSCKSSGSLGCNLSQTHSLNSRRTLMLMAQMRRISPFSCLKDRHDFE
FPQEEFDGNQFQKAQAISVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYIELFQQMNDLE
ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLMEKKYSPCAWEVVRAEIMRSLSFSTN
LQKKLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcattgccctttgctttaatgatggccctggtggtgctcagctgcaagtcaagtggc
tctctgggctgtaacctgtctcaaacccacagcctgaatagcaggaggactttgatgctc
atggcacaaatgaggagaatctctcctttctcctgcctgaaggacagacatgactttgaa
tttccccaggaggagtttgatggcaaccagttccagaaggctcaggccatctctgtcctc
catgagatgatccagcagatcttcaacctcttcagcacaaaggactcatctgctgcttgg
gatgagaccctcctagacaaattctacattgaacttttccagcaaatgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactgtttatctgatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcgacaaac
ttgcaaaaaaaattaaggaggaaggattga

KEGG   Pongo abelii (Sumatran orangutan): 100435254
Entry
100435254         CDS       T01416                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04620  Toll-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04940  Type I diabetes mellitus
pon05133  Pertussis
pon05134  Legionellosis
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05162  Measles
pon05164  Influenza A
pon05168  Herpes simplex virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05321  Inflammatory bowel disease
pon05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100435254 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100435254 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100435254 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    100435254 (IL12B)
   04625 C-type lectin receptor signaling pathway
    100435254 (IL12B)
   04658 Th1 and Th2 cell differentiation
    100435254 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100435254 (IL12B)
   05205 Proteoglycans in cancer
    100435254 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100435254 (IL12B)
   05330 Allograft rejection
    100435254 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100435254 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100435254 (IL12B)
   05134 Legionellosis
    100435254 (IL12B)
   05152 Tuberculosis
    100435254 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100435254 (IL12B)
   05164 Influenza A
    100435254 (IL12B)
   05162 Measles
    100435254 (IL12B)
   05168 Herpes simplex virus 1 infection
    100435254 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100435254 (IL12B)
   05145 Toxoplasmosis
    100435254 (IL12B)
   05140 Leishmaniasis
    100435254 (IL12B)
   05142 Chagas disease
    100435254 (IL12B)
   05143 African trypanosomiasis
    100435254 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100435254 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100435254 (IL12B)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100435254 (IL12B)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100435254 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_3 Ig_2 Ig_5 fn3 Ig_4 I-set
Other DBs
NCBI-GeneID: 100435254
NCBI-ProteinID: XP_002816186
Ensembl: ENSPPYG00000016000
UniProt: A0A663DH67 H2PH86
LinkDB
Position
5
AA seq 328 aa
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDRSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSFLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
RGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNANFSVRAQDRYYSSSWSEWASVPCS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtgtcaccagcagttggtcatctcttggttttccctggtttttctggcatctcccctc
gtggccatatgggaactgaagaaagatgtttatgtcgtagaattggattggtatccggat
gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg
accttggaccggagcagtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggctctaagccattcg
ttcctgctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaggaccag
aaagaacccaaaaataagacctttctaagatgcgaggccaagaattattctggacgtttc
acctgctggtggctgacaacaatcagtactgatttgacattcagtgtcaaaagcagcaga
ggctcttctgacccccaaggggtgacgtgcggagctgctacactctctgcagagagggtc
agaggggacaacaaggagtatgagtactcagtagagtgccaggaggacagtgcctgccca
gctgctgaggagaggctgcccattgaggtcatggtggatgctgttcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacctgacccacccaagaat
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acctggagtactccacattcctacttctccctgacattctgcgttcaggtccagggcaag
agcaagagagaaaagaaagatagagtcttcacagacaagacttcagccacggtcatctgc
cgcaaaaatgccaactttagcgtgcgggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcagttag

KEGG   Pongo abelii (Sumatran orangutan): 100437034
Entry
100437034         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-4-like
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100437034
   04151 PI3K-Akt signaling pathway
    100437034
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100437034
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100437034
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100437034
   04621 NOD-like receptor signaling pathway
    100437034
   04622 RIG-I-like receptor signaling pathway
    100437034
   04623 Cytosolic DNA-sensing pathway
    100437034
   04650 Natural killer cell mediated cytotoxicity
    100437034
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437034
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100437034
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100437034
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100437034
   05161 Hepatitis B
    100437034
   05160 Hepatitis C
    100437034
   05171 Coronavirus disease - COVID-19
    100437034
   05164 Influenza A
    100437034
   05162 Measles
    100437034
   05168 Herpes simplex virus 1 infection
    100437034
   05163 Human cytomegalovirus infection
    100437034
   05167 Kaposi sarcoma-associated herpesvirus infection
    100437034
   05169 Epstein-Barr virus infection
    100437034
   05165 Human papillomavirus infection
    100437034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100437034
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100437034
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 100437034
NCBI-ProteinID: XP_002819797
LinkDB
Position
9
AA seq 189 aa
MALSFPLLMAMLVLSCKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFNTKDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLTEKKYSPCAWEVVRAEVMRSFSYSTS
LQKRIRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtcctttcctttactgatggccatgctggtgctcagctgcaaatccatctgt
tctctgggctgtgatctgcctcagactcacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga
ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcaacacaaaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagatccttctcttattcaacaagc
ctgcaaaaaagaataaggaggaaggattga

KEGG   Pongo abelii (Sumatran orangutan): 100438149
Entry
100438149         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-4-like
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100438149
   04151 PI3K-Akt signaling pathway
    100438149
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100438149
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100438149
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100438149
   04621 NOD-like receptor signaling pathway
    100438149
   04622 RIG-I-like receptor signaling pathway
    100438149
   04623 Cytosolic DNA-sensing pathway
    100438149
   04650 Natural killer cell mediated cytotoxicity
    100438149
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100438149
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100438149
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100438149
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100438149
   05161 Hepatitis B
    100438149
   05160 Hepatitis C
    100438149
   05171 Coronavirus disease - COVID-19
    100438149
   05164 Influenza A
    100438149
   05162 Measles
    100438149
   05168 Herpes simplex virus 1 infection
    100438149
   05163 Human cytomegalovirus infection
    100438149
   05167 Kaposi sarcoma-associated herpesvirus infection
    100438149
   05169 Epstein-Barr virus infection
    100438149
   05165 Human papillomavirus infection
    100438149
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100438149
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100438149
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 100438149
NCBI-ProteinID: XP_003777418
LinkDB
Position
9
AA seq 189 aa
MALSFPLLMAMLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFGTKDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLTEKKYSPCAWEVVRAEVMRSFSYSTS
LQKRIRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtcctttcctttactgatggccatgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgattttgga
ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctctttggcacaaaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagatccttctcttattcaacaagc
ctgcaaaaaagaataaggaggaaggattga

KEGG   Pongo abelii (Sumatran orangutan): 100438871
Entry
100438871         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-17-like
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100438871
   04151 PI3K-Akt signaling pathway
    100438871
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100438871
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100438871
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100438871
   04621 NOD-like receptor signaling pathway
    100438871
   04622 RIG-I-like receptor signaling pathway
    100438871
   04623 Cytosolic DNA-sensing pathway
    100438871
   04650 Natural killer cell mediated cytotoxicity
    100438871
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100438871
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100438871
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100438871
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100438871
   05161 Hepatitis B
    100438871
   05160 Hepatitis C
    100438871
   05171 Coronavirus disease - COVID-19
    100438871
   05164 Influenza A
    100438871
   05162 Measles
    100438871
   05168 Herpes simplex virus 1 infection
    100438871
   05163 Human cytomegalovirus infection
    100438871
   05167 Kaposi sarcoma-associated herpesvirus infection
    100438871
   05169 Epstein-Barr virus infection
    100438871
   05165 Human papillomavirus infection
    100438871
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100438871
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100438871
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 100438871
NCBI-ProteinID: XP_002819799
LinkDB
Position
9
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQLQKAQAISVFHEMIQQTFNLFSTKDSSAAWDETLLNKFYIELFQQMNDLE
ACVIQEVGVEETPLMNVDSILAVRKYFQRITVYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKGLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga
ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcttc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gatgagaccctcctaaacaaattctacattgaacttttccagcaaatgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgtggactccatc
ctggctgtgaggaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaggattaaggaggaaggattga

KEGG   Pongo abelii (Sumatran orangutan): 100439978
Entry
100439978         CDS       T01416                                 

Gene name
IFNA21
Definition
(RefSeq) interferon alpha-21
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100439978 (IFNA21)
   04151 PI3K-Akt signaling pathway
    100439978 (IFNA21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100439978 (IFNA21)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100439978 (IFNA21)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100439978 (IFNA21)
   04621 NOD-like receptor signaling pathway
    100439978 (IFNA21)
   04622 RIG-I-like receptor signaling pathway
    100439978 (IFNA21)
   04623 Cytosolic DNA-sensing pathway
    100439978 (IFNA21)
   04650 Natural killer cell mediated cytotoxicity
    100439978 (IFNA21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439978 (IFNA21)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100439978 (IFNA21)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100439978 (IFNA21)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100439978 (IFNA21)
   05161 Hepatitis B
    100439978 (IFNA21)
   05160 Hepatitis C
    100439978 (IFNA21)
   05171 Coronavirus disease - COVID-19
    100439978 (IFNA21)
   05164 Influenza A
    100439978 (IFNA21)
   05162 Measles
    100439978 (IFNA21)
   05168 Herpes simplex virus 1 infection
    100439978 (IFNA21)
   05163 Human cytomegalovirus infection
    100439978 (IFNA21)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100439978 (IFNA21)
   05169 Epstein-Barr virus infection
    100439978 (IFNA21)
   05165 Human papillomavirus infection
    100439978 (IFNA21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100439978 (IFNA21)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100439978 (IFNA21)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100439978
NCBI-ProteinID: XP_002819800
UniProt: A0A2J8XIC9
LinkDB
Position
9
AA seq 189 aa
MALPFSLLMAVVVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFNTKDSSAAWEQSLLEKFSTELNQQLNDLE
ACMIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKT
FQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgcccttttctttactgatggccgtggtggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaagacagacatgatttcgga
ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcaacacaaaagactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaacttaaccagcaactgaacgacctggaa
gcctgtatgatacaggaggttggggtggaagagactcccctgatgaatgtggactccatc
ctggctgtgaagaaatacttccaaagaatcactctttatctcacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaaaaacc
tttcaagaaagattaaggaggaaggaatga

KEGG   Pongo abelii (Sumatran orangutan): 100440198
Entry
100440198         CDS       T01416                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon05310  Asthma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100440198 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100440198 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100440198 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440198 (IL9)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100440198 (IL9)
SSDB
Other DBs
NCBI-GeneID: 100440198
NCBI-ProteinID: XP_002815954
Ensembl: ENSPPYG00000015804
UniProt: A0A6D2WN59 H2PGL9
LinkDB
Position
5
AA seq 144 aa
MLLAMVLTSALLLCSVTGQGCPTLTGIMNINFLINKMQEDPASKCHCSANVTSCLCLPIP
SDNCTRPCFSEGLSQMTNSTVRTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGN
ALIFLKSLLEIFQKEKMRGMGGKI
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcttctggccatggtccttacctctgccctgctcctgtgctccgtcacaggccagggg
tgtccaaccttgacagggatcatgaacatcaacttcctcatcaacaagatgcaggaagat
ccagcttcgaagtgccactgcagtgctaatgtgaccagttgtctctgcctgcccattccc
tctgacaactgcaccagaccatgcttcagtgagggactgtctcagatgaccaatagcacc
gtgcgaacaagatacccactgattttcagtcgggtgaaaaaatcggttgaagtactaaag
aacaacaagtgtccatacttttcctgtgaacagccatgcaaccaaaccacggcaggcaac
gcactgatatttctgaagagtctcctggaaattttccagaaagaaaagatgagagggatg
ggaggaaaaatatga

KEGG   Pongo abelii (Sumatran orangutan): 100440345
Entry
100440345         CDS       T01416                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04622  RIG-I-like receptor signaling pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100440345
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100440345
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100440345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440345
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100440345
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100440345
NCBI-ProteinID: XP_002819801
Ensembl: ENSPPYG00000019184
UniProt: A0A6D2XIB3 H2PS26
LinkDB
Position
9
AA seq 195 aa
MALLFPLLAALVMTRYSPVGALGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRKDFR
FPQEMVEGSQLPKAQVVSVLHEMLQQIFSLFHTEHSSAAWNMTLLDQLHTGLHQQLQHLE
TCLVQVMGEGESFGAIRSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTN
MQERLRSKDRDLGSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccctcctgttccctctactggcagccctagtgatgaccagatatagccctgttgga
gctctgggctgtgatctgcctcagaaccatggtctacttagcaggaacaccttggtgctt
ctgcaccaaatgaggagaatctcccctttcttgtgtctcaaggacagaaaagacttcagg
ttcccccaggagatggtagaagggagccagctgccgaaggcccaggttgtgtctgtcctc
catgagatgctgcagcagatcttcagcctctttcacacagagcactcctctgctgcctgg
aacatgaccctcctagaccaactccacactggacttcatcagcaactgcaacacctggag
acctgcttggtgcaggtaatgggagaaggagaatcttttggggcaattaggagccctgca
ctgaccttgaggaggtacttccagggaatccgtgtctacctgaaagagaagaaatacagc
gactgtgcctgggaagttgtcagaatggaaatcatgaaatccttgttcttatcaacaaac
atgcaagaaagactgagaagtaaagatagagacctgggctcatcttga

KEGG   Pongo abelii (Sumatran orangutan): 100441074
Entry
100441074         CDS       T01416                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04668  TNF signaling pathway
pon05135  Yersinia infection
pon05142  Chagas disease
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100441074 (IFNB1)
   04668 TNF signaling pathway
    100441074 (IFNB1)
   04151 PI3K-Akt signaling pathway
    100441074 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100441074 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100441074 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100441074 (IFNB1)
   04621 NOD-like receptor signaling pathway
    100441074 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    100441074 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    100441074 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    100441074 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100441074 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100441074 (IFNB1)
   05152 Tuberculosis
    100441074 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100441074 (IFNB1)
   05161 Hepatitis B
    100441074 (IFNB1)
   05160 Hepatitis C
    100441074 (IFNB1)
   05171 Coronavirus disease - COVID-19
    100441074 (IFNB1)
   05164 Influenza A
    100441074 (IFNB1)
   05162 Measles
    100441074 (IFNB1)
   05168 Herpes simplex virus 1 infection
    100441074 (IFNB1)
   05163 Human cytomegalovirus infection
    100441074 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100441074 (IFNB1)
   05169 Epstein-Barr virus infection
    100441074 (IFNB1)
   05165 Human papillomavirus infection
    100441074 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100441074 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100441074 (IFNB1)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100441074 (IFNB1)
SSDB
Motif
Pfam: Interferon Forkhead
Other DBs
NCBI-GeneID: 100441074
NCBI-ProteinID: XP_002819803
Ensembl: ENSPPYG00000019185
UniProt: A0A6D2XNH4 H2PS27
LinkDB
Position
9
AA seq 187 aa
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGRFEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEYFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINR
LTGYLRN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt
tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag
ctcctgtggcaattgaatgggaggtttgaatattgcctcaaggacaggatgaactttgac
atccctgaggagattaagcagctgcagcagttccagaaggaggacgcggcattgaccatc
tacgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg
aatgagaccattgttgagaacctccttgctaatgtctatcatcagataaaccatctgaag
acagttctggaagaaaaactggagaaagaatatttcaccaggggaaaattcatgagcagt
ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagt
cactgtgcctggaccatagtcagagtggaaatcctcaggaactttttcttcattaacaga
cttacaggttacctccgaaactga

KEGG   Pongo abelii (Sumatran orangutan): 100443523
Entry
100443523         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-4-like
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100443523
   04151 PI3K-Akt signaling pathway
    100443523
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100443523
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100443523
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100443523
   04621 NOD-like receptor signaling pathway
    100443523
   04622 RIG-I-like receptor signaling pathway
    100443523
   04623 Cytosolic DNA-sensing pathway
    100443523
   04650 Natural killer cell mediated cytotoxicity
    100443523
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100443523
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100443523
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100443523
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100443523
   05161 Hepatitis B
    100443523
   05160 Hepatitis C
    100443523
   05171 Coronavirus disease - COVID-19
    100443523
   05164 Influenza A
    100443523
   05162 Measles
    100443523
   05168 Herpes simplex virus 1 infection
    100443523
   05163 Human cytomegalovirus infection
    100443523
   05167 Kaposi sarcoma-associated herpesvirus infection
    100443523
   05169 Epstein-Barr virus infection
    100443523
   05165 Human papillomavirus infection
    100443523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100443523
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100443523
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100443523
NCBI-ProteinID: XP_024108288
LinkDB
Position
9
AA seq 189 aa
MSLSFSLLMAMVVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFGTKDSSAAWEQSLLERFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSIMAVRKYFQRITVYLTEKKYSPCAWEVVRAEIMRSFSYATR
LQKRIRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga
ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcggcacaaaggactcatctgctgcttgg
gaacagagcctcctagaaagattttccactgaactttaccagcaactgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
atggctgtgaggaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctcttatgcaacaagg
ctgcaaaaaagaataaggaggaaggattga

KEGG   Pongo abelii (Sumatran orangutan): 100444043
Entry
100444043         CDS       T01416                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03050  Proteasome
pon04060  Cytokine-cytokine receptor interaction
pon04066  HIF-1 signaling pathway
pon04217  Necroptosis
pon04350  TGF-beta signaling pathway
pon04380  Osteoclast differentiation
pon04612  Antigen processing and presentation
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04940  Type I diabetes mellitus
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05164  Influenza A
pon05168  Herpes simplex virus 1 infection
pon05200  Pathways in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05321  Inflammatory bowel disease
pon05322  Systemic lupus erythematosus
pon05323  Rheumatoid arthritis
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100444043 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100444043 (IFNG)
   04630 JAK-STAT signaling pathway
    100444043 (IFNG)
   04066 HIF-1 signaling pathway
    100444043 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100444043 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100444043 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100444043 (IFNG)
   04612 Antigen processing and presentation
    100444043 (IFNG)
   04660 T cell receptor signaling pathway
    100444043 (IFNG)
   04658 Th1 and Th2 cell differentiation
    100444043 (IFNG)
   04659 Th17 cell differentiation
    100444043 (IFNG)
   04657 IL-17 signaling pathway
    100444043 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100444043 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444043 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100444043 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100444043 (IFNG)
   05323 Rheumatoid arthritis
    100444043 (IFNG)
   05321 Inflammatory bowel disease
    100444043 (IFNG)
   05330 Allograft rejection
    100444043 (IFNG)
   05332 Graft-versus-host disease
    100444043 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100444043 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100444043 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100444043 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100444043 (IFNG)
   05164 Influenza A
    100444043 (IFNG)
   05168 Herpes simplex virus 1 infection
    100444043 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100444043 (IFNG)
   05144 Malaria
    100444043 (IFNG)
   05145 Toxoplasmosis
    100444043 (IFNG)
   05140 Leishmaniasis
    100444043 (IFNG)
   05142 Chagas disease
    100444043 (IFNG)
   05143 African trypanosomiasis
    100444043 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:pon03051]
    100444043 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100444043 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100444043 (IFNG)
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100444043 (IFNG)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100444043 (IFNG)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100444043 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 Tup_N
Other DBs
NCBI-GeneID: 100444043
NCBI-ProteinID: XP_002823542
Ensembl: ENSPPYG00000004747
UniProt: A0A6D2Y737 H2NHZ4
LinkDB
Position
12
AA seq 166 aa
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcaactctgcatcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaacgca
ggtgattcagatgtagcggataatggaactcttttcttaggcattttgaagaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg
aatgtcaagtttttcaatagcaacaaaaagaaacgggatgacttcgaaaagctgactaat
tattcggtaactgacttgaacgtccaacgcaaagccatacatgaactcatccaagtgatg
gctgaactgtcgccagcagctaaaacagggaagcggaaaaggagtcagatgctgtttcga
ggtcgaagagcatcccagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100444770
Entry
100444770         CDS       T01416                                 

Gene name
IL22
Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04659  Th17 cell differentiation
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100444770 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100444770 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100444770 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100444770 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100444770 (IL22)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100444770 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 100444770
NCBI-ProteinID: XP_002823544
Ensembl: ENSPPYG00000004749
UniProt: A0A6D2X4Q7 A0A2J8W0T4
LinkDB
Position
12
AA seq 179 aa
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFRGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVP
FLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggccgccctgcagaaatctgtgagctctttccttatggggactctggccaccagctgc
ctccttctcttggccctcttggtacagggaggagcagctgcgcccatcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagcttggctgataacaatacagacgttcgcctcattggggagaaactgttc
cgcggagtcagtatgagtgagcgctgctatctgatgaagcaggtgctgaacttcaccctt
gaagaagtgctgttccctcaatctgataggttccagccttatatgcaagaggtggtgcct
ttcctggccaggctcagcaacaggctaagcacatgtcatattgaaggtgatgacctgcat
atccagaggaatgtgcaaaagctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagcaattggagaactggatttgctgtttatgtctctgagaaatgcctgcatttga

KEGG   Pongo abelii (Sumatran orangutan): 100444774
Entry
100444774         CDS       T01416                                 

Gene name
IL24
Definition
(RefSeq) interleukin-24 isoform X1
  KO
K22668  interleukin 24
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100444774 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100444774 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100444774 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100444774 (IL24)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100444774 (IL24)
SSDB
Motif
Pfam: IL22 IL10
Other DBs
NCBI-GeneID: 100444774
NCBI-ProteinID: XP_002809582
Ensembl: ENSPPYG00000000279
UniProt: H2N3X1 A0A6D2WDD1
LinkDB
Position
1
AA seq 207 aa
MNFQQRLQSLWSLASRSSCPPLLATGSQMQMAALPYLGFTLLLWSQVPGAQGQEFQFGPC
QVKGVVPQKLWEAFWAVKDTMQAQDNITSVRLLQQEVLQNVSDAESCYLVHTLLEFYLKT
VFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQ
LDVEAALTKALGEVDILLTWMQKFYKL
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaattttcaacagaggctgcaaagcctgtggagtttagccagcagatcctcctgccct
cctttgctggcgacaggctctcaaatgcagatggctgcgctcccttacctgggttttacc
ctgcttctctggagccaggtaccaggggcccagggccaagaattccaatttgggccctgc
caagtgaagggggttgttccccagaaactgtgggaagccttctgggctgtgaaagacact
atgcaagctcaggataacatcacgagtgtgcggctgctgcagcaggaggttctgcagaat
gtctcggatgctgagagctgttaccttgtccacaccctgctggagttctacttgaaaact
gttttcaaaaactatcacaatagaacagttgaagtcaggactctgaagtcattctctact
ctggccaacaactttgttctcattgtgtcacaactgcaacccagtcaagaaaatgagatg
ttttccatcagagacagtgcacacaggcggtttctgctattccggagagcattcaaacag
ttggacgtagaagcagctctgaccaaagcccttggggaagtggacattcttctgacctgg
atgcagaaattctacaagctttga

KEGG   Pongo abelii (Sumatran orangutan): 100444807
Entry
100444807         CDS       T01416                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04620  Toll-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04940  Type I diabetes mellitus
pon05133  Pertussis
pon05134  Legionellosis
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05162  Measles
pon05164  Influenza A
pon05168  Herpes simplex virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05321  Inflammatory bowel disease
pon05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100444807 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100444807 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100444807 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    100444807 (IL12A)
   04625 C-type lectin receptor signaling pathway
    100444807 (IL12A)
   04658 Th1 and Th2 cell differentiation
    100444807 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444807 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100444807 (IL12A)
   05330 Allograft rejection
    100444807 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100444807 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100444807 (IL12A)
   05134 Legionellosis
    100444807 (IL12A)
   05152 Tuberculosis
    100444807 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100444807 (IL12A)
   05164 Influenza A
    100444807 (IL12A)
   05162 Measles
    100444807 (IL12A)
   05168 Herpes simplex virus 1 infection
    100444807 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100444807 (IL12A)
   05144 Malaria
    100444807 (IL12A)
   05145 Toxoplasmosis
    100444807 (IL12A)
   05140 Leishmaniasis
    100444807 (IL12A)
   05142 Chagas disease
    100444807 (IL12A)
   05143 African trypanosomiasis
    100444807 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100444807 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100444807 (IL12A)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100444807 (IL12A)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100444807 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 100444807
NCBI-ProteinID: XP_002814285
Ensembl: ENSPPYG00000014253
UniProt: A0A6D2X537 H2PBV7
LinkDB
Position
3
AA seq 253 aa
MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLP
VATPGPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDQTSTVEACL
PLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL
MDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMNYLNAS
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcccagccaccgccctcacctgccgcggccacaggtctg
catccagcggctcgcccagtgtccctgcagtgccggctcagcatgtgtccagcgcgcagc
ctcctccttgtggctaccctggtcctcctggaccacctcagtttggccagaaacctccct
gtggccaccccaggcccaggaatgttcccgtgccttcaccactcccaaaacctgctgagg
gccgtcagcaacatgctccagaaggccagacaaactctagaattctacccttgcacttct
gaagagattgatcatgaagatatcacaaaagatcaaaccagcacagtggaggcctgttta
ccattggaattaaccaagaatgagagttgcctaaattccagagagacctctttcataact
aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttagtagt
atttatgaagacttgaagatgtaccaggtggagttcaagaccatgaatgcaaagcttctg
atggatcctaagaggcagatctttctagatcaaaacatgctggcagttattgatgagctg
atgcaggccctgaatttcaacagtgagactgtgccacaaaaatcctcccttgaagaaccg
gatttttataaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgaactatctgaatgcttcctaa

KEGG   Pongo abelii (Sumatran orangutan): 100445374
Entry
100445374         CDS       T01416                                 

Gene name
IL20
Definition
(RefSeq) interleukin-20
  KO
K22667  interleukin 20
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100445374 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100445374 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100445374 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100445374 (IL20)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100445374 (IL20)
SSDB
Motif
Pfam: IL10 Pou
Other DBs
NCBI-GeneID: 100445374
NCBI-ProteinID: XP_002809584
Ensembl: ENSPPYG00000000280
LinkDB
Position
1
AA seq 238 aa
MPAVPGLTCWALTAEPGRGQNKGATTCGTNSHSDSELRPESFSSREARQFFLLLWSPDFR
PKMKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVVATNLQEIRNGFSELRGSVQAKDG
NIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLT
IKKDLRLCHAHMTCHCGEEAMKKYSQTLSHFEELEPQAAVVKALGELDILLQWMEETE
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcctgctgttccaggccttacctgctgggcactaacggcggagccaggacggggccag
aataaaggagccacgacctgtggcaccaactcgcactcagactctgaactcagacctgaa
agcttctcttcacgggaggctcggcagtttttcttactcctgtggtctccagatttcagg
cctaagatgaaagcctctagtcttgccttcagccttctctctgctgcgttttatctccta
tggactccttccactggactgaagacactcaatttgggaagctgtgtggtcgccacaaac
cttcaggaaatacgaaatggattttctgagttacggggcagtgtgcaagccaaagatgga
aacattgacatcagaatcttaaggaggactgagtctttgcaagacacaaagcctgcgaat
cgatgctgcctcctgcgccatttgctaagactctatctggacagagtatttaaaaactac
cagacccctgaccattatactctccggaagatcagcagcctcgccaattcctttcttacc
atcaagaaggacctccggctctgtcatgcccacatgacatgccattgtggggaggaagca
atgaagaaatacagccagactctgagtcactttgaagagctggaacctcaggcagcagtt
gtgaaggctttgggggaactagacattcttctgcaatggatggaggagacagaatag

KEGG   Pongo abelii (Sumatran orangutan): 100445711
Entry
100445711         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-10-like
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100445711
   04151 PI3K-Akt signaling pathway
    100445711
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100445711
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100445711
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100445711
   04621 NOD-like receptor signaling pathway
    100445711
   04622 RIG-I-like receptor signaling pathway
    100445711
   04623 Cytosolic DNA-sensing pathway
    100445711
   04650 Natural killer cell mediated cytotoxicity
    100445711
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100445711
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100445711
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100445711
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100445711
   05161 Hepatitis B
    100445711
   05160 Hepatitis C
    100445711
   05171 Coronavirus disease - COVID-19
    100445711
   05164 Influenza A
    100445711
   05162 Measles
    100445711
   05168 Herpes simplex virus 1 infection
    100445711
   05163 Human cytomegalovirus infection
    100445711
   05167 Kaposi sarcoma-associated herpesvirus infection
    100445711
   05169 Epstein-Barr virus infection
    100445711
   05165 Human papillomavirus infection
    100445711
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100445711
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100445711
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100445711
NCBI-ProteinID: XP_003780011
LinkDB
Position
9
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFGTKDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVIRAEIMRSFSFSTN
LEKRLRKKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga
ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcggcacaaaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcaccctttatctgatggagaagaaatacagc
ccttgtgcctgggaggttatcagagcagaaatcatgagatccttctctttttcaacaaac
ttggaaaaaagattaaggaagaaggattga

KEGG   Pongo abelii (Sumatran orangutan): 100445757
Entry
100445757         CDS       T01416                                 

Gene name
IL19
Definition
(RefSeq) interleukin-19 isoform X2
  KO
K05444  interleukin 19
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100445757 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100445757 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100445757 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100445757 (IL19)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100445757 (IL19)
SSDB
Motif
Pfam: IL10 DUF1741
Other DBs
NCBI-GeneID: 100445757
NCBI-ProteinID: XP_003775483
LinkDB
Position
1
AA seq 177 aa
MKLQSVSLWLLGTILILCSVDNHGLRRCLISTDMHHTEESFQEIKRAIQAKDTFPNVTIL
STLETLQIIKPLDVCCVTRNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQ
CQEQRQCHCRQEATNVTRVIHDNYDQLEVRAAAIKSLGELDIFLAWIDKNHEVTSSA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaagttacagtctgtttccctttggctcctgggtacaatactgatattgtgctcagta
gacaaccatggtctcaggagatgtctgatttccacagacatgcaccatacagaagagagt
ttccaagaaatcaaaagagccattcaagctaaggacaccttcccaaatgtcactatcctg
tccacattggagactctgcagatcattaagcccttagatgtgtgctgcgtgaccaggaac
ctcctggcgttctacgtggacagggtgttcaaggatcatcaggagccaaaccccaaaatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaaactctgcggcaa
tgtcaggaacagaggcagtgtcactgcaggcaggaagccaccaatgtcaccagagtcatc
cacgacaactatgatcagctggaggtccgcgctgctgccattaaatccctgggagagctc
gacatctttctagcctggattgataagaatcatgaagtaacgtcctcagcctga

KEGG   Pongo abelii (Sumatran orangutan): 100446386
Entry
100446386         CDS       T01416                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04068  FoxO signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04660  T cell receptor signaling pathway
pon04672  Intestinal immune network for IgA production
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05150  Staphylococcus aureus infection
pon05152  Tuberculosis
pon05310  Asthma
pon05320  Autoimmune thyroid disease
pon05321  Inflammatory bowel disease
pon05322  Systemic lupus erythematosus
pon05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100446386 (IL10)
   04068 FoxO signaling pathway
    100446386 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100446386 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100446386 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100446386 (IL10)
   04660 T cell receptor signaling pathway
    100446386 (IL10)
   04672 Intestinal immune network for IgA production
    100446386 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100446386 (IL10)
   05322 Systemic lupus erythematosus
    100446386 (IL10)
   05320 Autoimmune thyroid disease
    100446386 (IL10)
   05321 Inflammatory bowel disease
    100446386 (IL10)
   05330 Allograft rejection
    100446386 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100446386 (IL10)
   05133 Pertussis
    100446386 (IL10)
   05150 Staphylococcus aureus infection
    100446386 (IL10)
   05152 Tuberculosis
    100446386 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100446386 (IL10)
   05144 Malaria
    100446386 (IL10)
   05145 Toxoplasmosis
    100446386 (IL10)
   05140 Leishmaniasis
    100446386 (IL10)
   05142 Chagas disease
    100446386 (IL10)
   05143 African trypanosomiasis
    100446386 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100446386 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100446386 (IL10)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100446386 (IL10)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100446386 (IL10)
SSDB
Motif
Pfam: IL10 IL22 ALIX_LYPXL_bnd CLZ
Other DBs
NCBI-GeneID: 100446386
NCBI-ProteinID: XP_002809587
Ensembl: ENSPPYG00000000282
UniProt: H2N3X4
LinkDB
Position
1
AA seq 178 aa
MHSSALLCCLVLLTGVRAGSGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKEHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVQQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcacagctcagcactgctctgttgcctggtcctcctgactggcgtgagggccggctca
ggccagggcacccagtctgagaacagctgcacccacttcccaggcaacctgcctaacatg
cttcgagatctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag
ctggacaacttgttgttaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
caagacccagacatcaaggagcatgtgaactccctgggggagaacctgaagaccctcagg
ctgaggctgcggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtgcag
caggtgaagaatgcctttaataagctccaagagaaaggcatctacaaagccatgagcgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacgaaactga

KEGG   Pongo abelii (Sumatran orangutan): 100447057
Entry
100447057         CDS       T01416                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04664  Fc epsilon RI signaling pathway
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05221  Acute myeloid leukemia
pon05310  Asthma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100447057 (IL3)
   04151 PI3K-Akt signaling pathway
    100447057 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100447057 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100447057 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100447057 (IL3)
   04664 Fc epsilon RI signaling pathway
    100447057 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447057 (IL3)
   05202 Transcriptional misregulation in cancer
    100447057 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100447057 (IL3)
  09163 Immune disease
   05310 Asthma
    100447057 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447057 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100447057 (IL3)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100447057 (IL3)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100447057 (IL3)
SSDB
Motif
Pfam: IL3 Ldl_recept_b
Other DBs
NCBI-GeneID: 100447057
NCBI-ProteinID: XP_002815901
Ensembl: ENSPPYG00000015753
UniProt: A0A663D7Y1 H2PGH1
LinkDB
Position
5
AA seq 152 aa
MSCLPVLLLLQLLVSPGLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNKAVKSLQNASAIESILKNLPPCLPMATAAPMRHPIRIKD
GDWNEFRRKLTFYLKTLENAQAQQMTLSVEIS
NT seq 459 nt   +upstreamnt  +downstreamnt
atgagctgcctgcccgtcctgctcctgctccaactcctggtcagccccggactccaagct
cccatgacccagacaacttccttgaagacaagctgggttaactgctctaacatgattgat
gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat
ggggaagaccaagacattctgatggaaaataacctccgaaggccaaacctggaggcattc
aacaaggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc
ccgccatgcctgcccatggccacggccgcacccatgcgacatccaatccgtatcaaggac
ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgca
caggctcaacagatgactttgagcgtcgagatctcttga

KEGG   Pongo abelii (Sumatran orangutan): 100447424
Entry
100447424         CDS       T01416                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04650  Natural killer cell mediated cytotoxicity
pon04657  IL-17 signaling pathway
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon05146  Amoebiasis
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05171  Coronavirus disease - COVID-19
pon05202  Transcriptional misregulation in cancer
pon05221  Acute myeloid leukemia
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100447424 (CSF2)
   04668 TNF signaling pathway
    100447424 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100447424 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100447424 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    100447424 (CSF2)
   04660 T cell receptor signaling pathway
    100447424 (CSF2)
   04657 IL-17 signaling pathway
    100447424 (CSF2)
   04664 Fc epsilon RI signaling pathway
    100447424 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100447424 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100447424 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100447424 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100447424 (CSF2)
   05171 Coronavirus disease - COVID-19
    100447424 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100447424 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100447424 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100447424 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447424 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100447424 (CSF2)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     100447424 (CSF2)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100447424 (CSF2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100447424 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 100447424
NCBI-ProteinID: XP_002815902
Ensembl: ENSPPYG00000015754
UniProt: A0A663DAI5 H2PGH3
LinkDB
Position
5
AA seq 144 aa
MWLQSLLLLGTVACSISAPARSLSPSTQPWEHVNAIQEARRLLNLSKDTAAEMNETVEVV
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagagcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcgctcagccccagcacgcagccctgggagcatgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtaaagacactgctgctgagatgaatgaaacagtagaagtcgtc
tcagaaatgtttgacctccaggagccgacctgcctacagacccgcctggagctgtacaag
cagggcctgcggggcagcctcaccaagctcaagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgtcatcccctttgactgctgggag
ccagtccaagagtga

KEGG   Pongo abelii (Sumatran orangutan): 100447454
Entry
100447454         CDS       T01416                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7 isoform X1
  KO
K05431  interleukin 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100447454 (IL7)
   04151 PI3K-Akt signaling pathway
    100447454 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100447454 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100447454 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447454 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447454 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100447454 (IL7)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100447454 (IL7)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100447454 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 100447454
NCBI-ProteinID: XP_002819245
Ensembl: ENSPPYG00000018691
UniProt: A0A6D2XIV8 A0A2J8V9Y2
LinkDB
Position
8
AA seq 177 aa
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCL
NNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQ
VKGRKPSALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
NT seq 534 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggacttcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagatggcaaacaatatgagagtgtt
ctaatggtcagcatcgatcaattattggacagcatgaaagaaattggtagcaattgcctg
aataatgaatttaacttttttaaaagacatatctgtgatgctaataaggaaggtatgttt
ttattccgtgctgctcgcaagttgaggcaatttcttaaaatgaatagcactggtgatttt
gatctccacttattaaaagtttcagaaggcacaacaatactgttgaactgcactggccag
gttaaaggaagaaaaccatctgccctaggtgaagcccaaccaacaaagagtttggaagaa
aataaatctttaaaggaacagaaaaaactgaatgacttgtgtttcctaaagagactacta
caagagataaaaacttgttggaataaaattttgatgggcactaaagaacactga

KEGG   Pongo abelii (Sumatran orangutan): 100447794
Entry
100447794         CDS       T01416                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04630  JAK-STAT signaling pathway
pon04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100447794 (LIF)
   04668 TNF signaling pathway
    100447794 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100447794 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100447794 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447794 (LIF)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100447794 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 100447794
NCBI-ProteinID: XP_009232526
Ensembl: ENSPPYG00000011702
UniProt: A0A6D2WSQ1 H2P409
LinkDB
Position
22
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgttggttctgcactggaaacatggg
gcggggagccccctccccatcacccctgtcaacgccacctgtgccatacgccacccatgt
cacaacaacctcatgaaccagatcaggagccaactggcacagctcaatggcagtgccaat
gccctctttattctctattacacagcccagggggagccattccccaacaacctggacaag
ctatgtggccccaacgtgacggacttcccgcccttccacgccaacggcacggagaaggcc
aagctggtggagctgtaccgcatagtcgtgtaccttggcacctccctgggcaacatcacc
cgggaccagaagatcctcaaccccagtgccctcagcctccatagcaagctcaacgccact
gccgacatcctgcgaggcctccttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtgggccacgtggatgtgacctacggccctgacacctcgggtaaggacgtcttccagaag
aagaagctgggctgtcaactcctggggaagtataagcagatcatcgccgtgttggcccag
gccttctag

KEGG   Pongo abelii (Sumatran orangutan): 100448170
Entry
100448170         CDS       T01416                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M isoform X1
  KO
K05418  oncostatin M
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100448170 (OSM)
   04151 PI3K-Akt signaling pathway
    100448170 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100448170 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448170 (OSM)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100448170 (OSM)
SSDB
Motif
Pfam: LIF_OSM IL23
Other DBs
NCBI-GeneID: 100448170
NCBI-ProteinID: XP_002831046
Ensembl: ENSPPYG00000011704
UniProt: H2P411 A0A663D964
LinkDB
Position
22
AA seq 252 aa
MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYHVLLGQLQKQTDLMQDTSRLLDPYI
RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA
QDLERSGLNIEDLEKLQMARPNVLGLRNNIYCMAQLLDNSDTAEPTKAGWGASQPPTPTP
ASDAFQRKLEGCRFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
GKRLMPRGQLPR
NT seq 759 nt   +upstreamnt  +downstreamnt
atgggggtactgctcacacagaggacgctgctcagtctggtccttgcactcctgtttcca
agcatggcgagcatggcggctataggcagctgctcgaaagagtaccacgtgctccttggc
cagctccagaagcagacagatctcatgcaggacaccagcagactcctggacccctatata
cgtatccaaggcctggatgttcctaaactgagagagcactgcagggagcgccccggggcc
ttccccagcgaggagaccctgagggggctgggcaggcggggcttcctgcagaccctcaat
gccacactgggctgcgtcctgcacagactggccgacttagagcagcgcctccccaaggcc
caggatttggagaggtctgggctgaacatcgaggacttggagaagctgcagatggcgagg
ccgaacgtcctcgggctcaggaacaacatctactgcatggcccagctgctggacaactca
gacacggctgagcccacgaaggctggctggggggcctctcagccgcccacccccacccct
gcctcggatgcttttcagcgcaagctggagggctgcagattcctgcgtggctaccatcgc
ttcatgcactcagtggggcgggtcttcagcaagtggggggagagcccaaaccggagccgg
agacacagcccccaccaggccctgaggaagggggtgcgcaggaccagaccctccaggaaa
ggcaagagactcatgcccaggggacagcttccccggtag

KEGG   Pongo abelii (Sumatran orangutan): 100448961
Entry
100448961         CDS       T01416                                 

Gene name
IL17D
Definition
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04657  IL-17 signaling pathway
pon04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100448961 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100448961 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100448961 (IL17D)
   04659 Th17 cell differentiation
    100448961 (IL17D)
   04657 IL-17 signaling pathway
    100448961 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448961 (IL17D)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100448961 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 100448961
NCBI-ProteinID: XP_024113469
LinkDB
Position
13
AA seq 202 aa
MLVAGFLLALPPGGAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQL
GPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCL
TGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSI
NSSIDKQGAKLLLGPNHAPAGP
NT seq 609 nt   +upstreamnt  +downstreamnt
atgctggtagccggcttcctgctggcgctgccgccgggcggggccgcgggcgccccgagg
gcgggcaggcgcccggcgcggccgcggggctgcgcggaccggccggaagagctactggag
cagctgtacgggcgcctggcggccggcgtgctcagcgccttccaccacacgctgcagctg
gggccgcgtgagcaggcgcgcaacgcgagctgcccggcagggggcaggcccgccgaccgc
cgcttccggccgcccaccaacctgcgcagcgtgtcgccctgggcctacagaatctcctac
gacccggcgaggtaccccaggtacctgcctgaagcctactgcctgtgccggggctgcctg
accgggctgttcggcgaggaggacgtgcgcttccgcagcgcccctgtctacatgcccacc
gtcgtcttgcgccgtacccccgcctgcgccggcggccgctccgtctacaccgaggcctac
gtcaccatccccgtgggctgcacctgcgtccccgagccggagaaggacgcagacagcatc
aactccagcatcgacaaacagggcgccaagctcctgctgggccccaaccacgcgcccgct
ggcccctga

KEGG   Pongo abelii (Sumatran orangutan): 100450694
Entry
100450694         CDS       T01416                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04672  Intestinal immune network for IgA production
pon05200  Pathways in cancer
pon05310  Asthma
pon05320  Autoimmune thyroid disease
pon05321  Inflammatory bowel disease
pon05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100450694 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100450694 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100450694 (IL5)
   04660 T cell receptor signaling pathway
    100450694 (IL5)
   04658 Th1 and Th2 cell differentiation
    100450694 (IL5)
   04657 IL-17 signaling pathway
    100450694 (IL5)
   04664 Fc epsilon RI signaling pathway
    100450694 (IL5)
   04672 Intestinal immune network for IgA production
    100450694 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450694 (IL5)
  09163 Immune disease
   05310 Asthma
    100450694 (IL5)
   05320 Autoimmune thyroid disease
    100450694 (IL5)
   05321 Inflammatory bowel disease
    100450694 (IL5)
   05330 Allograft rejection
    100450694 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100450694 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100450694 (IL5)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100450694 (IL5)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100450694 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 100450694
NCBI-ProteinID: XP_002815911
Ensembl: ENSPPYG00000015763
LinkDB
Position
5
AA seq 132 aa
MLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQL
CTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEF
LGVMNTEWVIES
NT seq 399 nt   +upstreamnt  +downstreamnt
atgcttctgcatttgagtttgctagctcttggagctgcctatgtatatgccatccccaca
gaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcatcgaact
ctgctgatagccaatgagactctgaggattcctgttcctgtacataaaaatcaccaactg
tgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaagggggt
actgtggaaagactattcaaaaacttgtctttaataaagaaatacattgacggccaaaaa
aaaaagtgtggagaagaaagacggagagtaaaccaattcttagactacctgcaagagttt
cttggtgtaatgaacaccgagtgggtaatagaaagttga

KEGG   Pongo abelii (Sumatran orangutan): 100451066
Entry
100451066         CDS       T01416                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13 isoform X1
  KO
K05435  interleukin 13
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04664  Fc epsilon RI signaling pathway
pon05200  Pathways in cancer
pon05310  Asthma
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100451066 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100451066 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100451066 (IL13)
   04657 IL-17 signaling pathway
    100451066 (IL13)
   04664 Fc epsilon RI signaling pathway
    100451066 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451066 (IL13)
  09163 Immune disease
   05310 Asthma
    100451066 (IL13)
   05321 Inflammatory bowel disease
    100451066 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100451066 (IL13)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100451066 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 100451066
NCBI-ProteinID: XP_002815912
Ensembl: ENSPPYG00000015765
UniProt: A0A6D2WSF9 H2PGI3
LinkDB
Position
5
AA seq 146 aa
MRPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP
LCNGSMVWSINLTAGVYCAALESLVNVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD
TKIEVAQFVKDLLLHLKKLFREGRFN
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcgtccgctcctcaatcctctcctgttggcactgggcctcatggcactcttgttgacc
acggtcattgctctcacttgcctcggtggctttgcctccccaggccctgtgcctccctct
acagccctcagggagctcattgaggagctggtcaacatcacccagaaccagaaggccccg
ctctgcaatggcagcatggtgtggagcatcaacctgacagctggcgtgtactgtgcggcc
ctggaatccctggtcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg
agcggattctgcccgcacaaggtctcagctgggcagttctccagcttgcatgtccgagac
accaaaatcgaggtggcccagtttgtaaaggacctgctcttacatttaaagaaacttttt
cgcgagggacggttcaactga

KEGG   Pongo abelii (Sumatran orangutan): 100451705
Entry
100451705         CDS       T01416                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform X1
  KO
K05430  interleukin 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04672  Intestinal immune network for IgA production
pon05140  Leishmaniasis
pon05200  Pathways in cancer
pon05310  Asthma
pon05320  Autoimmune thyroid disease
pon05321  Inflammatory bowel disease
pon05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100451705 (IL4)
   04151 PI3K-Akt signaling pathway
    100451705 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100451705 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100451705 (IL4)
   04660 T cell receptor signaling pathway
    100451705 (IL4)
   04658 Th1 and Th2 cell differentiation
    100451705 (IL4)
   04659 Th17 cell differentiation
    100451705 (IL4)
   04657 IL-17 signaling pathway
    100451705 (IL4)
   04664 Fc epsilon RI signaling pathway
    100451705 (IL4)
   04672 Intestinal immune network for IgA production
    100451705 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451705 (IL4)
  09163 Immune disease
   05310 Asthma
    100451705 (IL4)
   05320 Autoimmune thyroid disease
    100451705 (IL4)
   05321 Inflammatory bowel disease
    100451705 (IL4)
   05330 Allograft rejection
    100451705 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100451705 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100451705 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100451705 (IL4)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100451705 (IL4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100451705 (IL4)
SSDB
Motif
Pfam: IL4 Mannosyl_trans3
Other DBs
NCBI-GeneID: 100451705
NCBI-ProteinID: XP_002815914
Ensembl: ENSPPYG00000015766
UniProt: A0A663D5P8 H2PGI4
LinkDB
Position
5
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFVHGHKCDIALQEIIKTLNSLTEQKTLCTELTVTDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKEANQSTLEDFLERLKTIMREKYSKCSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgtccatggacacaagtgcgatatcgccttacaagagatcatcaaaactttgaacagc
ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgtctgggtgcgactgcacagcagttccacagacac
aagcagctcatccgattcctgaaacggctcgacaggaacctctggggcctggcgggtttg
aattcctgtcctgtgaaggaagccaaccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgagagaaaaatattcaaagtgttcgagctga

KEGG   Pongo abelii (Sumatran orangutan): 100452384
Entry
100452384         CDS       T01416                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04659  Th17 cell differentiation
pon05133  Pertussis
pon05152  Tuberculosis
pon05200  Pathways in cancer
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100452384 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100452384 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100452384 (IL23A)
   04659 Th17 cell differentiation
    100452384 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452384 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100452384 (IL23A)
   05321 Inflammatory bowel disease
    100452384 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100452384 (IL23A)
   05152 Tuberculosis
    100452384 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100452384 (IL23A)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100452384 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 100452384
NCBI-ProteinID: XP_002823443
Ensembl: ENSPPYG00000004657
UniProt: H2NHP9 A0A6D2XRD3
LinkDB
Position
12
AA seq 189 aa
MLGSRAVMLLLLLSWTAQGRAVPGGGSPAWAQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgtcctggacagctcagggcaga
gctgtgcctgggggcggcagccctgcctgggctcagtgccagcagctttcacagaagctc
tgcacactggcctggagtgcacatccactagtgggacacatggatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttac
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctattgggcctcagccaactcctgcagcctgagggtcac
cactgggagactcagcagattccaagcctcagtcccagccagccatggcagcgcctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagccgcccgggtcttt
gcccatggagcagcaaccctgagtccctaa

KEGG   Pongo abelii (Sumatran orangutan): 100452433
Entry
100452433         CDS       T01416                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100452433 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100452433 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100452433 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100452433 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100452433 (IL11)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100452433 (IL11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 100452433
NCBI-ProteinID: XP_024094095
LinkDB
Position
19
AA seq 199 aa
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgtgtttgccgcctggtcctggtcgtgctgagcctgtggccagatacagctgtc
gcccctgggcccccacctggcccccctcgagtttccccagaccctcgggccgagctggac
agcaccgtgctcctgacccgctctctcctggcggacacgcggcagctggctgcacagctg
agggacaaattcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agtgcgggggcactgggagctctacagctcccgggtgtgctgacaaggctgcgagcggac
ctactgtcctacctgcggcacgtgcagtggctgcgccgggcaggtggctcttccctgaag
accctggagcccgagctgggcaccctgcaggcccggctggaccggctgctgcgccggctg
cagctcctgatgtcccgtctggccctgccccagccacccccagacccgccggcacccccg
ctggcgcccccctcctcagcctgggggggtatcagggccgcccacgccatcctggggggg
ctgcacctgacacttgactgggccgtgagaggactgctgctgctgaagactcggctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100453716
Entry
100453716         CDS       T01416                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04622  RIG-I-like receptor signaling pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100453716 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100453716 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100453716 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100453716 (IFNK)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100453716 (IFNK)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100453716
NCBI-ProteinID: XP_002819772
Ensembl: ENSPPYG00000019155
UniProt: A0A6D2VVW8 H2PRZ6
LinkDB
Position
9
AA seq 207 aa
MSTKPDMIQKCLWLEFLMGMFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECL
RENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQ
QAEYLNQCLEEDENENEDMKEMKENEMKPSEARVPQLSNLELRRYFNRIDNFLKEKKYSD
CAWEIVRVEIRRCLYYFYKFTALFRRK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagcaccaaacctgatatgattcaaaagtgtttgtggcttgagttccttatgggtatg
ttcattgctggcaccctatccctggactgtaacttactgaacgttcacctgagaagagtc
acctggcaaaatctgagacatctgagtagtatgagcaattcatttcctgtagaatgtcta
cgagaaaacatagcttttgagttgccccaagagtttctgcaatacacccaacctatgaag
agggacatcaagaaggccttctatgaaatgtccctacaggccttcaacatcttcagccaa
cacaccttcaaatattggaaagagagacacctcaaacaaatccaaataggacttgatcag
caagcagagtacctgaaccaatgcttggaggaagacgagaatgaaaacgaagacatgaaa
gaaatgaaagagaatgagatgaaaccctcagaagccagggtcccccagctgagcaacctg
gaactgaggagatatttcaacaggatagacaatttcctgaaagaaaagaaatacagtgac
tgtgcctgggagattgtccgagtggaaatcagaagatgtttgtactacttttacaaattt
acagctctattcaggagaaaataa

KEGG   Pongo abelii (Sumatran orangutan): 100453941
Entry
100453941         CDS       T01416                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 isoform X2
  KO
K05405  interleukin 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01523  Antifolate resistance
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04218  Cellular senescence
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04657  IL-17 signaling pathway
pon04659  Th17 cell differentiation
pon04668  TNF signaling pathway
pon04672  Intestinal immune network for IgA production
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05010  Alzheimer disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05134  Legionellosis
pon05135  Yersinia infection
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05144  Malaria
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
pon05332  Graft-versus-host disease
pon05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100453941 (IL6)
   04668 TNF signaling pathway
    100453941 (IL6)
   04066 HIF-1 signaling pathway
    100453941 (IL6)
   04068 FoxO signaling pathway
    100453941 (IL6)
   04151 PI3K-Akt signaling pathway
    100453941 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100453941 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100453941 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100453941 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100453941 (IL6)
   04620 Toll-like receptor signaling pathway
    100453941 (IL6)
   04621 NOD-like receptor signaling pathway
    100453941 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100453941 (IL6)
   04625 C-type lectin receptor signaling pathway
    100453941 (IL6)
   04659 Th17 cell differentiation
    100453941 (IL6)
   04657 IL-17 signaling pathway
    100453941 (IL6)
   04672 Intestinal immune network for IgA production
    100453941 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453941 (IL6)
   05202 Transcriptional misregulation in cancer
    100453941 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100453941 (IL6)
   05321 Inflammatory bowel disease
    100453941 (IL6)
   05332 Graft-versus-host disease
    100453941 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100453941 (IL6)
   05020 Prion disease
    100453941 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    100453941 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100453941 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100453941 (IL6)
   04931 Insulin resistance
    100453941 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100453941 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100453941 (IL6)
   05135 Yersinia infection
    100453941 (IL6)
   05133 Pertussis
    100453941 (IL6)
   05134 Legionellosis
    100453941 (IL6)
   05152 Tuberculosis
    100453941 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100453941 (IL6)
   05161 Hepatitis B
    100453941 (IL6)
   05171 Coronavirus disease - COVID-19
    100453941 (IL6)
   05164 Influenza A
    100453941 (IL6)
   05162 Measles
    100453941 (IL6)
   05168 Herpes simplex virus 1 infection
    100453941 (IL6)
   05163 Human cytomegalovirus infection
    100453941 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100453941 (IL6)
   05169 Epstein-Barr virus infection
    100453941 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100453941 (IL6)
   05144 Malaria
    100453941 (IL6)
   05142 Chagas disease
    100453941 (IL6)
   05143 African trypanosomiasis
    100453941 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100453941 (IL6)
   01523 Antifolate resistance
    100453941 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100453941 (IL6)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100453941 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 Phage_int_SAM_1 GCSF
Other DBs
NCBI-GeneID: 100453941
NCBI-ProteinID: XP_002818205
Ensembl: ENSPPYG00000017740
UniProt: A0A6D2YB13 A0A2J8VE68
LinkDB
Position
7
AA seq 212 aa
MNSVSTSAFGPVAFSLGLLLVLPAALPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttacctgccccagtaccaccaggagaagattccaaagatgtagcc
gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc
ctcgacggcatctcagccctgagaaaggagacttgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacaggtttgagagcagtgaggaacaagcc
agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataactacccctgacccaaccacgaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtag

KEGG   Pongo abelii (Sumatran orangutan): 100455248
Entry
100455248         CDS       T01416                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04151  PI3K-Akt signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04672  Intestinal immune network for IgA production
pon04940  Type I diabetes mellitus
pon05135  Yersinia infection
pon05142  Chagas disease
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
pon05321  Inflammatory bowel disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100455248 (IL2)
   04151 PI3K-Akt signaling pathway
    100455248 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100455248 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100455248 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100455248 (IL2)
   04660 T cell receptor signaling pathway
    100455248 (IL2)
   04658 Th1 and Th2 cell differentiation
    100455248 (IL2)
   04659 Th17 cell differentiation
    100455248 (IL2)
   04672 Intestinal immune network for IgA production
    100455248 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100455248 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100455248 (IL2)
   05321 Inflammatory bowel disease
    100455248 (IL2)
   05330 Allograft rejection
    100455248 (IL2)
   05332 Graft-versus-host disease
    100455248 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100455248 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100455248 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100455248 (IL2)
   05171 Coronavirus disease - COVID-19
    100455248 (IL2)
   05162 Measles
    100455248 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100455248 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100455248 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100455248 (IL2)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100455248 (IL2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100455248 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 100455248
NCBI-ProteinID: XP_002815161
Ensembl: ENSPPYG00000015043
UniProt: H2PE89 A0A6D2XRS9
LinkDB
Position
4
AA seq 153 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agacccagggacttaatcagcaatatcaatgtaatagttctggaactaaagggatctgaa
acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga
tggattaccttttgtcaaagcatcatctcaacactgacttga

KEGG   Pongo abelii (Sumatran orangutan): 100455621
Entry
100455621         CDS       T01416                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21
  KO
K05434  interleukin 21
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04659  Th17 cell differentiation
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100455621 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100455621 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100455621 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100455621 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100455621 (IL21)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100455621 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 100455621
NCBI-ProteinID: XP_002815162
Ensembl: ENSPPYG00000015044
UniProt: H2PE90 A0A6D2XS22
LinkDB
Position
4
AA seq 162 aa
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEF
LPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRL
TCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaggattgtcatctgtctgatggtcatcttcttg
gggacactggtccacaaatcaagctcccaaggtcaagatcgccacatgattagaatgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggtccctgaattt
ctgccagctccagaagatgtagagacaaactgtgagtggtcagctttttcctgttttcag
aaggcccaactaaagtcagcaaatacaggaaacaatgaaaggataatcaatgtatcaatt
aaaaagctgaagaggaaaccaccttccacaaatgcagggagaagacagaaacacagacta
acatgcccttcatgtgattcttatgagaaaaaaccacccaaagaattcctagaaagattc
aaatcacttctccaaaagatgattcatcagcatctgtcctctagaacacacggaagtgaa
gattcctga

KEGG   Pongo abelii (Sumatran orangutan): 100456813
Entry
100456813         CDS       T01416                                 

Gene name
IL15
Definition
(RefSeq) interleukin-15
  KO
K05433  interleukin 15
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04668  TNF signaling pathway
pon04672  Intestinal immune network for IgA production
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100456813 (IL15)
   04668 TNF signaling pathway
    100456813 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100456813 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100456813 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100456813 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100456813 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100456813 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100456813 (IL15)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100456813 (IL15)
SSDB
Motif
Pfam: IL15 Late_protein_L2
Other DBs
NCBI-GeneID: 100456813
NCBI-ProteinID: XP_002815213
Ensembl: ENSPPYG00000015085
UniProt: A0A6D2VSK0 A0A2J8XP28
LinkDB
Position
4
AA seq 162 aa
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTSIHDTVENLIILANN
SLSANGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtatttccatccagtgctacttgtgtttactt
ctaaacagtcattttctaactgaagctggcattcatgtcttcattttgggctgtttcagt
gcagggcttcctaaaacagaagccaactgggtgaatgtaataagtgatttgaaaaaaatt
gaagatcttattcaatctatgcatattgatgctactttgtatacggaaagtgatgttcac
cccagttgcaaagtaacagcaatgaagtgctttctcttggagttacaagttatttcacat
gagtccggagacacaagtattcatgatacagtagaaaatcttatcatcctagcaaacaac
agtttgtctgctaatgggaatgtaacggaatctggatgcaaagaatgtgaggaactggag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatcaac
acttcttga

KEGG   Pongo abelii (Sumatran orangutan): 100457198
Entry
100457198         CDS       T01416                                 

Gene name
TSLP
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100457198 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100457198 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100457198 (TSLP)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100457198 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 100457198
NCBI-ProteinID: XP_002815824
Ensembl: ENSPPYG00000015678
UniProt: A0A6D2WD09 H2PG88
LinkDB
Position
5
AA seq 159 aa
MKCLGQSKKEEVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKS
TEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEVFAMKTKAALALWCPGYSETQINA
TQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFNRPLLKQQ
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaagtgtttagggcaaagcaaaaaggaggaagtttctttcaggaaaatcttcatctta
caacttgtagggctggtgctaacttacgacttcactaactgtgactttgagaagattaaa
gcagcctatctcagtactatttctaaagacctgattacatatatgagtgggaccaaaagt
accgagttcaacaacaccgtctcctgtagcaatcggccacactgccttactgaaatccag
agcctaaccttcaatcccaccgccggctgcgcgtcgctcgccaaagaagtgttcgccatg
aaaactaaggctgccttagctctctggtgcccaggctattcggaaactcagataaatgct
actcaggcaatgaagaagaggagaaaaaggaaagtcacaaccaataaatgtctggaacaa
gtgtcacaattactaggattgtggcgtcgcttcaatcgacctttactgaaacaacagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100458631
Entry
100458631         CDS       T01416                                 

Definition
(RefSeq) interferon lambda-3-like
  KO
K22669  interferon lambda 2/3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100458631
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100458631
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100458631
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100458631
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 100458631
NCBI-ProteinID: XP_024093200
Ensembl: ENSPPYG00000009958
LinkDB
Position
19
AA seq 200 aa
MKLDMTGGCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCRSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEAATDTDPALV
DVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTF
NLFRLLTRDLNCFASGDLCV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaactagacatgaccgggggctgcatgccagtgctggtgctgatggccgcagtgctg
accgtgactggagcagttcctgtcgccaggctccgtggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacaggagctgcaggcctttaagagggcc
aaagatgccttagaagagtcacttctgctgaaggactgcaggtgccgctcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccatggctttggaggct
gagctggccctgacgctgaaggttctggaggccgccactgacactgacccagccctggtg
gatgtcttggaccagccccttcacaccctgcaccacatcctctcccagctccgggcctgt
atccagcctcagcccacggcagggcccaggacccggggccgcctccaccattggctgcac
cggctccaggaggccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcacgcgagacctgaattgtttcgccagcggggacttgtgtgtc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100459543
Entry
100459543         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-10
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100459543
   04151 PI3K-Akt signaling pathway
    100459543
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100459543
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100459543
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100459543
   04621 NOD-like receptor signaling pathway
    100459543
   04622 RIG-I-like receptor signaling pathway
    100459543
   04623 Cytosolic DNA-sensing pathway
    100459543
   04650 Natural killer cell mediated cytotoxicity
    100459543
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459543
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100459543
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100459543
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100459543
   05161 Hepatitis B
    100459543
   05160 Hepatitis C
    100459543
   05171 Coronavirus disease - COVID-19
    100459543
   05164 Influenza A
    100459543
   05162 Measles
    100459543
   05168 Herpes simplex virus 1 infection
    100459543
   05163 Human cytomegalovirus infection
    100459543
   05167 Kaposi sarcoma-associated herpesvirus infection
    100459543
   05169 Epstein-Barr virus infection
    100459543
   05165 Human papillomavirus infection
    100459543
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459543
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100459543
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100459543
NCBI-ProteinID: XP_002834152
UniProt: A0A2J8XIC1
LinkDB
Position
9
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFE
FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFGTKDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLTEKKYSPCAWEVVRAEIMRSFSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaatagaagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgaa
tttccccaggaggaatttgatggcaaccagttgcagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcggcacaaaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Pongo abelii (Sumatran orangutan): 100459981
Entry
100459981         CDS       T01416                                 

Definition
(RefSeq) interferon lambda-3
  KO
K22669  interferon lambda 2/3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100459981
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100459981
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459981
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100459981
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 100459981
NCBI-ProteinID: XP_002829243
Ensembl: ENSPPYG00000009959
UniProt: H2NYR7
LinkDB
Position
19
AA seq 200 aa
MKLDMTGGCMPVLMLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCRSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEAATDTDPALV
DVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTF
NLFRLLTRDLNCVASGDLCV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaactagacatgaccgggggctgcatgccagtgctgatgctgatggccgcagtgctg
actgtgactggagcagttcctgtcgccaggctccgcggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacaggagctgcaggcctttaagagggcc
aaagatgccttagaagagtcacttctgctgaaggactgcaggtgccgctcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccatggctttggaggct
gagctggccctgacgctgaaggttctggaggccgccactgacactgacccagccctggtg
gatgtcttggaccagccccttcacaccctgcaccacatcctctcccagctccgggcctgt
atccagcctcagcccacggcagggcccaggacccggggccgcctccaccattggctgcac
cggctccaagaggctccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcacgcgagacctgaattgtgtcgccagtggggacttgtgtgtc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100460595
Entry
100460595         CDS       T01416                                 

Definition
(RefSeq) interferon lambda-1
  KO
K05447  interferon lambda 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100460595
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100460595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100460595
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   100460595
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 100460595
NCBI-ProteinID: XP_002829244
Ensembl: ENSPPYG00000009960
UniProt: H2NYR8
LinkDB
Position
19
AA seq 200 aa
MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIDRFKSLSPQELASFKKARDALEES
LKLKNWSCSCPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHT
LHHILSQLQACIQAQPTAGPRPRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRD
LKCVANGDLCLRTSTHSEST
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctgcagcttggactgtggtgctggtgactttggtgctaggcttggccgtggcaggc
cctgtccccacttccaagcccaccacaaccgggaagggctgccacattgacaggttcaaa
tctctgtcaccgcaggagctagcgagcttcaagaaggccagggacgccttggaagagtca
ctcaagctgaaaaactggagttgcagctgtcctgtcttccccgggaattgggacctgagg
cttctccaggtgagggagcgccctgtggccttggaggctgagctggccctgacgctgaag
gtcctggaggccgctgctggcccagccctggaggacgtcctagaccagccccttcacacc
ctgcaccacatcctctcccagctccaggcctgtatccaggctcagcccacggcagggccc
aggccccggggccgcctccaccactggctgcaccggctccaggaggcccccaaaaaggag
tcccctggctgcctggaggcgtctgtcaccttcaacctcttccgcctcctcacgcgagac
ctcaaatgtgtggccaatggggacctgtgtctgagaacgtcaacccactccgagtccacc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100462417
Entry
100462417         CDS       T01416                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin-1 isoform X1
  KO
K05422  cardiotrophin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100462417 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100462417 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100462417 (CTF1)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100462417 (CTF1)
SSDB
Motif
Pfam: LIF_OSM pPIWI_RE_X PRF NolB
Other DBs
NCBI-GeneID: 100462417
NCBI-ProteinID: XP_024089732
LinkDB
Position
16
AA seq 201 aa
MSRREGSLEDPQADSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGAANRGPRAEPPAAAASAASATGVFPAKVLGLRVCGL
YREWLSRTEGDLGQLLPGGSA
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaagacccccaggctgattcctcagtctcacttctt
ccccacttggaggccaagatccgtcagacacacagccttgcgcacctcctcaccaaatac
gctgagcagctgctccaggaatatgtgcagctccagggagaccccttcgggctgcccagc
ttctcgccgccgcggctgccggtggccggcctgagcgccccggccccgagccacgcgggg
ctgccagtgcacgagcggctgcggctggacgcggcggcgctggccgcgctgcccccgctg
ctggacgcagtgtgccgccgccaggccgagctgaacccgcgcgcgccgcgcctgctgcgc
cgcctggaggacgcggcgcgccaggcccgggccctgggcgccgccgtggaagccttgctg
gccgcgctgggcgccgccaaccgcgggccccgggccgagccccccgccgccgccgcctct
gccgcctccgccaccggggtcttccccgccaaggtgctggggctccgcgtttgcggcctc
taccgcgagtggctgagccgcaccgagggcgacctgggccagctgctgcccgggggctcg
gcctga

KEGG   Pongo abelii (Sumatran orangutan): 112134962
Entry
112134962         CDS       T01416                                 

Definition
(RefSeq) interferon alpha-10-like
  KO
K05414  interferon alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112134962
   04151 PI3K-Akt signaling pathway
    112134962
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112134962
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112134962
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112134962
   04621 NOD-like receptor signaling pathway
    112134962
   04622 RIG-I-like receptor signaling pathway
    112134962
   04623 Cytosolic DNA-sensing pathway
    112134962
   04650 Natural killer cell mediated cytotoxicity
    112134962
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112134962
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112134962
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112134962
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112134962
   05161 Hepatitis B
    112134962
   05160 Hepatitis C
    112134962
   05171 Coronavirus disease - COVID-19
    112134962
   05164 Influenza A
    112134962
   05162 Measles
    112134962
   05168 Herpes simplex virus 1 infection
    112134962
   05163 Human cytomegalovirus infection
    112134962
   05167 Kaposi sarcoma-associated herpesvirus infection
    112134962
   05169 Epstein-Barr virus infection
    112134962
   05165 Human papillomavirus infection
    112134962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    112134962
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interferons
   112134962
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 112134962
NCBI-ProteinID: XP_024108413
LinkDB
Position
9
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFE
FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFSTKDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLTEKKYSPCAWEVVRAEIMRSFSFSTN
LQKRIRRKY
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaatagaagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgaa
tttccccaggaggaatttgatggcaaccagttgcagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactgtttatctcacagagaagaaatatagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac
ttgcaaaaaagaataaggaggaagtattga

DBGET integrated database retrieval system