KEGG   Pongo abelii (Sumatran orangutan): 100431403
Entry
100431403         CDS       T01416                                 

Gene name
RECK
Definition
(RefSeq) reversion-inducing cysteine-rich protein with Kazal motifs isoform X1
  KO
K17461  reversion-inducing-cysteine-rich protein with kazal motifs
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100431403 (RECK)
SSDB
Motif
Pfam: Kazal_2 Kazal_1 DB Ldl_recept_a DNA_pol_E_B
Other DBs
NCBI-GeneID: 100431403
NCBI-ProteinID: XP_009242549
Ensembl: ENSPPYG00000019072
LinkDB
Position
9
AA seq 971 aa
MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSE
SRLKHLLQRAPDYCPETMVEIWSCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQA
SSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQI
KAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNACKRILMSKKTEM
EIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTST
CRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGCRNLTYCTNFN
NRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIK
PCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRP
STLGNIVEEVTHPCNPNPCPANELCEVNRKGCPSGDPCLPYFCVQGCKLGEASDFIVRQG
TLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNV
CSCFAGNLVCSTRLCLSEHSSEDDRRTFTGLPCNCADQFVPVCGQNGRTYPSACIARCVG
LQDHQFEFGSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFDKFGCSQYECVPRQLACDQVQ
DPVCDTDHMEHNNLCTLYQRGKSLSYKGPCQPFCRATEPVCGHNGETYSSVCAAYSDRVA
VDYYGDCQAVGVLSEHSSVAECASVKCPSLLAAGCKPIIPPGACCPLCAGMLRVLFDKEK
LDTIAKVTNKKPITVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIIPVDHYPKALQIE
ACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSVPSAGIRARLSCHSFLLPLSL
GLALHLLWTYN
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggcgaccgtccgggcctctctgcgaggcgcgctgctccttctgctggccgtggcgggg
gtcgcggaggtggcagggggcctggctccgggcagtgcgggtgcattgtgttgtaatcat
tcaaaggataaccaaatgtgccgtgatgtatgtgaacagattttctcctcaaaaagtgaa
tcccgactaaaacatctgttgcagcgagccccagattattgcccagagacaatggttgaa
atttggagttgtatgaattcatctttgccaggtgtgtttaagaagtctgatggctgggtt
ggcttaggctgctgtgaactggctattgccttggagtgtcgacaggcatgcaagcaggca
tcttcaaagaatgatatttccaaagtttgcagaaaagaatatgagaatgctcttttcagt
tgcattagcagaaatgaaatgggctcggtttgttgcagttatgcaggtcatcacacaaac
tgccgagaatactgtcaagccatttttcgaacagactcttctcctggtccatctcagatc
aaagcagtggaaaattattgtgcctctattagtccacaattaatacattgtgtgaacaat
tatactcaatcttatccaatgaggaacccaacggatagtttatattgctgtgacagagct
gaagaccatgcttgccaaaatgcctgcaagagaatcctgatgtccaagaaaacggaaatg
gagattgttgatggtctcatcgagggttgtaagacccagcccttgcctcaagatcctctt
tggcaatgttttcttgaaagctcacaatctgttcaccctggagtcactgtacaccctcct
ccctctacaggccttgatggggctaaattgcattgttgttctaaagcaaacacttcaaca
tgtagggaactctgcactaaactttacagcatgagctggggcaatacacagagttggcaa
gagtttgatcgcttttgtgaatataatccagtagaagtgtccatgttgacctgtttagcg
gatgtccgggaaccttgccagttgggctgtagaaaccttacttactgtactaattttaac
aacaggccaacagaacttttcagaagttgtaatgcacagtcagatcaaggagccatgaat
gacatgaagttgtgggagaaaggaagcataaagatgccatttatcaatatacctgttctt
gatattaaaaagtgccagccagagatgtggaaagcaatagcttgttcactgcagattaaa
ccttgtcatagtaaatctcgaggaagcattatttgcaaatcagattgtgtggagattctt
aaaaaatgtggagaccagaacaaattccctgaagaccacacagctgaaagtatttgtgag
cttctgtcacctacagatgatctgaagaattgtatacctttggatacatacctcaggcca
agtactttaggtaacattgtagaagaagtgactcatccctgtaacccaaatccttgccct
gccaatgagctctgtgaagtaaaccgaaaaggatgtccatctggagatccctgtcttcca
tacttttgtgttcaaggttgcaaactgggagaagcttctgatttcattgtccgtcaaggg
acactaattcaggtgccatcatctgcaggggaagttggttgttataaaatctgttcatgt
ggacagagtggactcttagaaaactgtatggaaatgcactgtatagacctccagaagtct
tgtattgttggaggaaaaagaaaaagtcatggaacatcctttagtattgactgcaatgtc
tgttcttgttttgctggcaatttggtgtgttctacccgcctttgcctcagtgagcacagt
tcagaagatgaccgtcgtaccttcacaggtctgccctgtaactgtgcagatcagtttgtt
cccgtatgtgggcagaatgggcgcacttaccccagtgcctgcattgctcgttgtgtgggc
ctccaagaccatcagtttgagtttggatcttgcatgtcaaaggatccatgtaatcctaat
ccctgccagaaaaaccaaaggtgcatacccaaaccacaggtctgcctgacgacttttgat
aaatttggatgtagccagtatgagtgtgtaccaagacagcttgcgtgtgaccaggtccaa
gatcctgtttgtgacacagaccacatggagcacaacaatctctgcactttataccaaaga
ggaaaaagcctctcttacaaaggcccctgccagcccttttgcagagcaaccgagcccgta
tgtgggcacaatggtgagacctacagcagcgtgtgtgctgcctactcggatcgtgtggcg
gtcgattactatggggactgccaggccgttggggtcctctcagagcacagctccgttgcc
gagtgtgcttctgtcaagtgtccttcactcttggcagctggatgcaaacccatcatccca
ccgggtgcttgttgcccattatgtgctgggatgttaagagttttatttgacaaagaaaaa
ctggatactattgctaaggtaacaaataaaaagccaataacagttctggaaatacttcag
aaaatccgcatgcacgtgtctgtcccacagtgtgacgtgtttggatacttcagcattgaa
tcagaaattgtgatcctgatcattcccgtcgatcactatccaaaagctctgcagattgaa
gcctgcaataaagaagcagagaagattgagtcccttatcaactctgacagcccgactttg
gcgtcccatgtccctctctctgccctcatcatttcccaggtacaggtctccagcagtgtg
ccatcagccggcatcagggccaggctttcttgccactccttcctccttcccctcagcttg
ggccttgccttgcacttgctctggacgtataactga

DBGET integrated database retrieval system