KEGG   Pongo abelii (Sumatran orangutan): 100431449
Entry
100431449         CDS       T01416                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100431449 (WNT3)
   04390 Hippo signaling pathway
    100431449 (WNT3)
   04150 mTOR signaling pathway
    100431449 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100431449 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100431449 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431449 (WNT3)
   05206 MicroRNAs in cancer
    100431449 (WNT3)
   05205 Proteoglycans in cancer
    100431449 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100431449 (WNT3)
   05226 Gastric cancer
    100431449 (WNT3)
   05217 Basal cell carcinoma
    100431449 (WNT3)
   05224 Breast cancer
    100431449 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100431449 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    100431449 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100431449 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100431449 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100431449 (WNT3)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100431449 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100431449
NCBI-ProteinID: XP_002827437
Ensembl: ENSPPYG00000008292
UniProt: A0A6D2W3S5 H2NTP4
LinkDB
Position
17
AA seq 355 aa
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctcggtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttgggcctgtccttgacaaagccacccgcgagtcggccttcgtgcacgccatcgcctcg
gccggcgtggccttcgccgtcacccgctcctgcgccgagggcacctccacgatttgcggc
tgtgactcgcatcataaggggccgcctggcgaaggctggaagtggggcggctgcagcgag
gacgctgacttcggggtgttagtgtccagggagttcgcggatgcgcgcgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgactatcctggac
cacatgcacctcaaatgcaagtgccacgggctgtcaggcagctgtgaggtgaagacctgc
tggtgggcgcagcctgacttccgtgccatcggcgacttcctcaaggacaagtatgacagc
gcctcggagatggtagtagagaagcaccgtgagtcccgaggctgggtggagaccctccgg
gccaagtactcgctcttcaagccacccaccgaaagggacctggtctactatgagaactcc
cccaacttttgtgagcctaacccagagacgggttcctttggcacaagggaccggacttgc
aatgtcacctcccacggcatcgatggctgcgatctgctctgctgtggccggggccacaac
acgaggacggagaagcggaaggaaaaatgccactgcatcttccactggtgctgctacgtc
agctgccaggagtgtattcgcatctacgacgtgcacacctgcaagtag

KEGG   Pongo abelii (Sumatran orangutan): 100448240
Entry
100448240         CDS       T01416                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a isoform X1
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100448240 (WNT3A)
   04390 Hippo signaling pathway
    100448240 (WNT3A)
   04150 mTOR signaling pathway
    100448240 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100448240 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100448240 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448240 (WNT3A)
   05206 MicroRNAs in cancer
    100448240 (WNT3A)
   05205 Proteoglycans in cancer
    100448240 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100448240 (WNT3A)
   05226 Gastric cancer
    100448240 (WNT3A)
   05217 Basal cell carcinoma
    100448240 (WNT3A)
   05224 Breast cancer
    100448240 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100448240 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    100448240 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100448240 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100448240 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448240 (WNT3A)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100448240 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100448240
NCBI-ProteinID: XP_002809409
Ensembl: ENSPPYG00000000150
UniProt: H2N3H7
LinkDB
Position
1
AA seq 385 aa
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRIYDVHTCKNPGSRAGN
SAHQPPHPQPPVRFHPPLCRAGKVP
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggccccgctcggatacttcttactcctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtcgctggctgttgggccacagtattcctccctgggctcgcagcccatc
ctgtgtgccagcatcccgggcctggtccccaagcagctccgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagattggcatccaggagtgccagcaccag
ttccgcggccgccggtggaactgcaccaccgtccatgacagcctggccatcttcgggcct
gtgctggacaaagctaccagggagtcagcctttgtccacgccattgcctcagccggtgtg
gcctttgcggtgacacgctcatgtgcagaaggcacggccgccatctgtggctgcagcagc
cgccaccagggctcaccaggcaagggctggaagtggggtggctgtagcgaggacatcgag
tttggtgggatggtgtctcgggagttcgccgacgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaacgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacatgctggtggtcg
caacccgacttccgcgccatcggtgacttcctcaaggacaagtacgacagcgcctcggag
atggtggtggagaagcaccgggagtcccgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccccgagacgggctccttcggcacgcgcgaccgcacctgcaacgtcagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgagcc
gagcggcgccgggagaagtgccgctgcgtgttccactggtgctgctacgtcagctgccag
gagtgcacgcgcatctacgacgtgcacacctgcaagaatcccggctccagagcagggaat
tcagcccaccagccccctcatccccaaccccctgtaaggttccatccacccctgtgtcga
gctgggaaggttccatga

DBGET integrated database retrieval system