KEGG   Pongo abelii (Sumatran orangutan): 100431481
Entry
100431481         CDS       T01416                                 

Gene name
BCR
Definition
(RefSeq) breakpoint cluster region protein
  KO
K08878  breakpoint cluster region protein [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05200  Pathways in cancer
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431481 (BCR)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100431481 (BCR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100431481 (BCR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100431481 (BCR)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100431481 (BCR)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: Other
  BCR family
   100431481 (BCR)
Membrane trafficking [BR:pon04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100431481 (BCR)
SSDB
Motif
Pfam: RhoGAP Bcr-Abl_Oligo RhoGEF PH_19 C2 PH IQ_SEC7_PH PH_5
Other DBs
NCBI-GeneID: 100431481
NCBI-ProteinID: XP_002830947
Ensembl: ENSPPYG00000011622
UniProt: H2P3R7
LinkDB
Position
22
AA seq 1271 aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQAPDGASEHRASASHPQPAPADGADPPPAEEPEARPDGE
GSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQSGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHSAGLSVGDASRPPYRGRASESSC
GVDGDYEDAELNPRFLKDNLINANGGSRPPWPPLEYQPYQSIYVGGMMEGEGRGPLLRSQ
STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG
AFHGDADGSFGTPPGYGCAADRAEDQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDTLVSG
ALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQQVGDLFQKLASQLGVYRAFVDNYGV
AMEMAEKCCQANAQFAEISENLRARSNKDAKDPTAKNSLETLLYKPVDRVTRSTLVLHDL
LKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE
GARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDESEAVPNIPLVP
DEELDALKIKISQIKSDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN
GKSYTFLISSDYERAEWRENIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHSIPLTIN
KEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE
EFEIELEGSQTLRILCYEKCYNKMKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVI
AMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIER
RGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLF
TDEFYPNFVEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSL
HNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDS
KRQSILFSTEV
NT seq 3816 nt   +upstreamnt  +downstreamnt
atggtggacccggtgggcttcgcggaggcgtggaaggcgcagttcccggactcagagccg
ccgcgcatggagctgcgctcagtgggcgacatcgagcaggagctggagcgctgcaaggcc
tccattcggcgcctggagcaggaggtgaaccaggagcgcttccgcatgatctacctgcag
acgttgctggccaaggaaaagaagagctatgaccggcagcgctggggcttccggcgcgcg
gcgcaggcccccgacggcgcctccgagcaccgagcgtccgcgtcgcacccacagcccgcg
cccgccgacggagccgacccgccgcccgccgaggagcccgaggcccggcccgacggcgag
ggttctccgggtaaggccaggcccgggaccgcccgcaggcccggggcagccgcgtcgggg
gaacgggacgaccgggggccccccgccagcgtggcggcgctcaggtccaacttcgagcgg
atccgcaagggccatggccagtccggggcggacgccgagaagcccttctacgtgaacgtc
gagtttcaccacgagcgcggcctggtgaaggtcaacgacaaagaggtgtcggaccgcatc
agctccctgggcagccaggccatgcagatggagcgcaaaaagtcccagcacagcgcgggc
ttgagcgtgggggatgcatccaggcccccttaccggggacgcgcctcagagagcagctgc
ggcgtcgacggcgactacgaggacgccgagttgaacccccgcttcctgaaggacaacctg
atcaacgccaatggcggtagcaggcccccttggccgcccctggagtaccagccctaccag
agcatctacgtcgggggcatgatggaaggggagggcaggggtccgctcctgcgcagccag
agcacctctgagcaggagaagcgccttacctggccccgcaggtcctactccccccggagt
tttgaggattgcggaggcggctataccccggactgcagctccaatgagaacctcacctcc
agcgaggaggacttctcctccggccagtccagccgcgtgtccccaagccccaccacctac
cgcatgttccgggacaagagccgctctccctcgcagaactcgcaacagtccttcgacagc
agcagtccccccacgccgcagtgccataagcggcaccggcactgcccggttgtcgtgtcc
gaggccaccatcgtgggcgtccgcaagaccgggcagatctggcccaacgatggcgagggc
gccttccatggagacgcagatggctcgttcggaacaccacctggatacggctgtgctgca
gaccgggcagaggaccagcgccggcaccaagacgggctgccctacattgatgactcgccc
tcctcatcgccccacctcagcagcaagggcaggggcagccgggatacgctggtctcggga
gccctggagtccactaaggcgagtgagctggacttggaaaagggcttggagatgagaaaa
tgggtcctgtctggaatactggctagcgaggagacttacctgagccacctggaggcactg
ctgctgcccatgaagcctttgaaagccgctgccaccacctctcagccggtgctgacgagt
cagcagatcgagaccatcttcttcaaagtgcctgagctctacgagatccacaaggagttc
tatgatgggctcttcccccgcgtgcagcagtggagccaccagcagcaggtgggcgacctc
ttccagaagctggccagccagctgggtgtgtaccgggcctttgtggacaactacggagtt
gccatggaaatggctgagaagtgctgtcaggccaatgctcagtttgcagaaatctccgag
aacctgagagccagaagcaacaaagatgccaaggatccaacggccaagaactctctggaa
actctgctctacaagcctgtggaccgtgtgacgaggagcacgctggtcctccatgacttg
ctgaagcacactcctgccagccacccagaccaccccttgctgcaggacgccctccgcatc
tcacagaacttcctgtccagcatcaacgaggagatcacaccccgacggcagtccatgacg
gtgaagaagggagagcaccggcagctgctgaaggacagcttcatggtggagctggtggag
ggggcccgcaagctgcgccacgtcttcctcttcaccgacctgcttctctgcaccaagctc
aagaagcagagcggaggcaaaacgcagcagtatgactgcaaatggtacattccgctcacg
gatctcagcttccagatggtggatgaatcggaggcagtgcccaacatccccctggtgccg
gacgaggagctggacgctttgaagatcaagatctcccagatcaaaagtgacatccagaga
gagaagagggcgaacaagggcagcaaggccacggagaggctgaagaagaagctgtcagag
caggagtcgctgctgctgcttatgtctcccagcatggccttcagggtgcacagccgcaat
ggcaagagttacacgttcctgatctcctctgactatgagcgtgcagagtggagggaaaac
atccgggagcagcagaagaagtgtttcaaaagcttctccctgacatccgtggagctgcag
atgctgaccaactcgtgtgtgaaactccagaccgtccacagcattccgctgaccatcaac
aaggaagatgatgagtctccggggctctatgggtttctgaatgtcatcgtccactcagcc
actggatttaagcagagttcaaatctgtactgcaccctggaggtggattcctttgggtat
tttgtgaataaagcaaagacgcgcgtctacagggacacagctgagccaaactggaacgag
gaatttgagatagagctggagggctcccagaccctgaggatactgtgctatgaaaagtgt
tacaacaagatgaagatccccaaggaggatggcgagagcacggacagactcatggggaag
ggccaggtccagctggacccacaggccctgcaggacagagactggcagcgcactgtcatc
gccatgaatgggattgaagtaaagctctcggtcaagttcaatagcagggagttcagcttg
aagaggatgccgtcccgaaaacagacgggggtcttcggagtcaagattgctgtggtcacc
aagagagagaggtccaaggtgccctatatcgtgcgccagtgtgtggaggagatcgagcgc
cgaggcatggaggaggtgggcatctaccgcgtgtccggagtggccacggacattcaggca
ctgaaggcagccttcgacgtcaataacaaggacgtgtcggtgatgatgagcgagatggac
gtgaacgccatcgcaggcacgctgaagctgtacttccgtgagctgcctgagcccctcttc
actgacgagttctaccccaacttcgtagagggcatcgctctttcagacccggttgcaaag
gagagctgcatgctcaacctgctgctgtccctgccggaggccaacctgctcaccttcctt
ttccttctggaccacctgaaaagggtggcagagaaggaggcagtcaataagatgtccctg
cacaaccttgccacggtctttggccccacgctgctccggccctccgagaaggagagcaag
ctccctgccaaccccagccagcccatcaccatgactgacagctggtccttggaggtcatg
tcccaggtccaggtgctgctgtacttcctgcagctggaggccatccctgccccggacagc
aagagacagagtatcctgttctccaccgaagtctaa

KEGG   Pongo abelii (Sumatran orangutan): 100453216
Entry
100453216         CDS       T01416                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04110  Cell cycle
pon04360  Axon guidance
pon04722  Neurotrophin signaling pathway
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05220  Chronic myeloid leukemia
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100453216 (ABL1)
   04014 Ras signaling pathway
    100453216 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100453216 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100453216 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    100453216 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453216 (ABL1)
   05206 MicroRNAs in cancer
    100453216 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100453216 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100453216 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100453216 (ABL1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100453216 (ABL1)
Protein kinases [BR:pon01001]
 Non-receptor tyrosine kinases
  ABL family
   100453216 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 100453216
NCBI-ProteinID: XP_024107872
LinkDB
Position
9
AA seq 1149 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGRKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSA
LLQAPELPTKTRTSRRAAEHRDATDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPE
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDI
SNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATG
EEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQ
VTVASASGLPYKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHS
SESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPLQSPSQEVAGEAVLGAKTKASSLVDAV
NSDAAKPSQPGESLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTA
FIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGK
NLYTFCVSYVDSIQQMRNKFAFREAINKLENHLRELQICPATAGSGPAATQDFSKLLSSV
KEISDIVQR
NT seq 3450 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagaaggccaagcttgcctgccctg
cattttatcaaaggagcagggaggaaggaatcatcgaggcatgggggtccacactgcaat
gtttttgtggaacatgaagcccttcagcggccagtagcatctgactttgagcctcagggt
ctgagtgaagccgctcgttggaactccaaggaaaaccttctcgctggacccagtgaaaat
gaccccaaccttttcgttgcactgtatgattttgtggccagtggagataacactctaagc
ataactaaaggtgaaaagctccgggtcttaggctataatcacaatggggaatggtgtgaa
gcccaaaccaaaaatggccaaggctgggtcccaagcaactacatcacgccagtcaacagt
ctggagaaacactcctggtaccatgggcctgtgtcccgcaatgctgctgagtatctgctg
agcagcgggatcaatggcagcttcttggtgcgtgagagtgagagcagtcctggccagagg
tccatctcgctgagatacgaagggagggtgtaccattacaggatcaacactgcttctgat
ggcaagctctacgtctcctccgagagccgcttcaacaccctggccgagctggttcatcat
cattcaacagtggccgatgggctcatcaccacgctccattatccagcccccaagcgcaac
aagcccactgtctacggtgtgtcgcccaactacgacaagtgggagatggaacgcacggac
atcaccatgaagcacaagctgggcgggggccagtatggggaggtgtacgagggcgtgtgg
aagaaatacagcctgacggtggccgtgaagaccttgaaggaggacaccatggaggtggaa
gagttcttgaaagaagctgcagtcatgaaagagatcaaacaccctaacctggtgcagctc
cttggggtctgcacgcgggagcccccgttctatatcatcactgagttcatgacctacggg
aacctcctggactacctgagggagtgcaaccggcaggaggtgaacgccgtggtgctgctg
tacatggccactcagatctcgtcagccatggagtacctggagaagaaaaacttcatccac
agagatcttgctgcccgaaactgcctggtaggggagaaccacttggtgaaggtagctgat
tttggcctgagcaggttgatgacaggggacacctacacagcccatgctggagccaagttc
cccatcaaatggactgcacccgagagcctggcctacaacaagttctccatcaagtctgac
gtctgggcatttggagtcttgctttgggaaattgctacctatggcatgtccccttacccg
ggaattgacctgtcccaggtgtatgagctgctagagaaggactaccgcatggagcgccca
gaaggctgcccagagaaggtctatgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctcctttgctgaaatccaccaagcctttgaaacaatgttccaggaatccagt
atctcagacgaagtggaaaaggagctggggaaacaaggcgtccgtggggctgtgagtgcc
ttgctgcaggccccagagctgcccaccaagacaaggacctccaggagagctgcggagcac
agagacgctactgacgtgcctgagatgcctcactccaagggccagggagagagcgatcct
ctggaccatgagcctgccgtgtctccattgctccctcgaaaagagcgaggtcccccggag
ggtggcctgaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttcagc
gccttgatcaagaagaagaagaagacagccccaacccctcccaaacgcagcagctccttc
cgggagatggacggccagccggagcgcagaggagccggcgaggaagagggccgagacatc
agcaacggggctctggctttcacccccttggacacagctgacccagccaagtccccaaag
cccagcaatggggctggggtccccaatggagccctccgggagtccgggggctcaggcttc
cggtctccccacctgtggaagaagtccagcacgctgaccagcagccgcctagccactggc
gaggaagagggtggtggcagctccagcaagcgcttcctgcgctcctgctccgcttcctgc
gttccccacggggccaaggacacggagtggaggtcagtcacgctgcctcgggacttgcag
tccacgggaagacagtttgactcgtccacatttggagggcacaaaagtgagaagccggct
ctgcctcggaagagggcaggggagaacaggtctgaccaggtgacccgaggcacagtaacg
cccccccccaggctggtgaaaaagaacgaggaagctgctgatgaggtcttcaaagacatc
atggagtccagcccgggttccagcccacccaacctgactccaaaacccctccggcggcag
gtcaccgtggcctctgcctcgggcctcccctacaaggaagaagctggaaagggcagtgcc
ttagggacccctgctgcagctgagccagtgacccccaccagcaaagcaggctcaggtgca
ccagggggcaccagcaagggccccgccgaggagtccagagtgaggaggcacaagcactcc
tctgagtcgccagggagggacaaggggaaattgtccaggctcaaacctgccccgccgccc
ccaccagcagcctctgcagggaaggctggaggaaagcccttgcagagcccgagccaggag
gtggccggggaggcggtcctgggcgcaaagacaaaagcctcaagtctggttgatgctgtg
aacagtgacgctgccaagcccagccagccgggagagagcctcaaaaagcccgtgctccca
gccactccaaagccacagtccgccaagccatcggggacccccatcagcccagcccctgtt
ccctccacgttgccatcagcatcctcggccctggcaggggaccagccatcttccaccgcc
ttcatccctctcatatcgacccgagtgtctcttcggaaaacccgccagcctccagagcgg
atcgccagtggcgccatcactaagggcgtggtcctggacagcaccgaggcgctgtgcctc
gccatctctaggaactccgagcagatggccagccacagcgcagtgctcgaggcaggcaaa
aacctctacacattctgcgtgagctacgtggattccatccagcaaatgaggaacaagttt
gccttccgagaggccatcaacaaactggagaatcatctccgggagcttcagatctgcccg
gcgacagcaggcagtggtccggcggccactcaggacttcagcaagctcctcagttcggtg
aaggaaatcagtgacatagtgcagaggtag

DBGET integrated database retrieval system