KEGG   Pongo abelii (Sumatran orangutan): 100431482
Entry
100431482         CDS       T01416                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X2
  KO
K02085  adenomatosis polyposis coli protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100431482 (APC)
   04390 Hippo signaling pathway
    100431482 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100431482 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100431482 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431482 (APC)
   05206 MicroRNAs in cancer
    100431482 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100431482 (APC)
   05225 Hepatocellular carcinoma
    100431482 (APC)
   05226 Gastric cancer
    100431482 (APC)
   05217 Basal cell carcinoma
    100431482 (APC)
   05213 Endometrial cancer
    100431482 (APC)
   05224 Breast cancer
    100431482 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100431482 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    100431482 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100431482 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100431482 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100431482 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100431482 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100431482 (APC)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100431482 (APC)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100431482 (APC)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100431482 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 100431482
NCBI-ProteinID: XP_002815830
Ensembl: ENSPPYG00000015685
UniProt: H2PG96
LinkDB
Position
5
AA seq 2844 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQAT
EAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGS
LDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTS
QEDRSSGSTTELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSS
NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE
LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTE
STDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
TNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYTTDIPSSQKQSFSFSKS
SSGQSTKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQTQKAATCKVSSINQETIQ
TYCVEDTPICFSRCSSLSSLSSAEDEIGCGQTTQEADSANTLQIAEIKEKIVTRSTEDPV
SEVPAVSQHTRTKSSRLQGSNLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQET
PLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPP
PPPQTAQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGF
SCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSE
KDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPS
QNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAVGEGVRGGAQ
SGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKP
FRVKKIMDQVQQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLN
AERVFPDNKDSKKQNLKNNSKDFNDKVPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRND
SLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINR
GQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENN
NNKENEPVKETEPPDSQGEPSKPQAAGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLL
QECISSAMPKKKKPSRLKGDNEKHSPRNMGGILAEDLTLDLKDIQRPDSEHGLSPDSENF
DWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPF
TSNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQA
NMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVK
SELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPMQSPGRNSISPGRNGISPP
NKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASK
GLNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEES
ASFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYND
GRPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSE
SSEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEISPTNSTSQTVSSGATNGAE
SKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGNPNIKDSKD
NQAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTETKPGQNNPVPVSETNESSIVER
TPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSK
TDSTESSGTQSPKRHSGSYLVTSV
NT seq 8535 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacaactacaaggaagtattgaagatgaagctatg
gcttcttctggacagattgatttattagagcgtcttaaagagcttaacttagatagcagt
aatttccctggagtaaaactacggtcaaaaatgtccctccgttcttatggaagccgggaa
ggatctgtatcaagccgttctggagagtgcagtcctgttcctatgggttcatttccaaga
agagggtttgtaaatggaagcagagaaagtactggatatttagaagaacttgagaaagag
aggtcattgcttcttgctgatcttgacaaagaagaaaaggaaaaagactggtattacgct
caacttcagaatctcactaaaagaatagatagtcttcctttaactgaaaatttttcctta
caaacagatatgaccagaaggcaattggaatatgaagcgaggcaaatcagagttgcgatg
gaagaacaactaggtacctgccaggatatggaaaaacgagcacagcgaagaatagccaga
attcagcaaatcgaaaaggacatacttcgtatacgacagcttttacagtcccaagcaaca
gaagctgagaggtcatctcagaacaagcatgaaaccggctcacatgatgctgagcggcag
aatgaaggtcaaggagtgggagaaatcaacatggcaacttctggtaatggtcagggttca
actacacgaatggaccacgaaacagccagtgttttgagttctagtagcacacactctgca
cctcgaaggctgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcgcgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctttta
catggcaatgacaaagactctgtattgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgcgcttactgtgaaacctgt
tgggagtggcaggaagctcatgaacaaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcagatctgtcctgctgtgtgtgttctaatgaaactttcatttgatgaa
gagcatagacatgcaatgaatgaactagggggactacaggccattgcagaattattgcaa
gtggactgtgaaatgtatgggcttaccaatgaccactacagtattacactaagacgatat
gctggaatggctttgacaaacttgacttttggagatgtagccaacaaggctacgctatgc
tctatgaaaggctgcatgagagcacttgtggcccaactaaaatctgaaagtgaagactta
cagcaggttattgcaagtgttttgaggaatttgtcttggcgagcagatgtaaatagtaaa
aagacattgcgggaagttggaagtgtgaaagcattgatggaatgtgctttagaagttaaa
aaggaatcaaccctcaaaagcgtattgagtgccttatggaatttgtcagcacattgcact
gagaataaagctgatatatgtgctgtagatggtgcacttgcatttttggttggcactctt
acttaccggagccagacaaacactttagccattattgaaagtggaggtgggatattacgg
aatgtgtccagcttgatagctacaaatgaggaccacaggcaaatcctaagagagaacaac
tgtctacaaactttattacaacacttaaaatctcatagtttgacaatagtcagtaatgca
tgtggaactttgtggaatctctcagcaagaaaccctaaagaccaggaagcattatgggac
atgggggcagttagcatgctcaagaacctcattcattcaaagcacaaaatgattgctatg
ggaagtgctgcagctttaaggaatctcatggcaaataggcctgcgaagtacaaggatgcc
aatattatgtctcctggctcaagcttgccatctcttcatgttaggaaacaaaaagcccta
gaagcagaattagatgctcagcatttatcagaaacttttgacaatatagacaatttaagt
cccaaggcatctcatcgtagtaagcaaagacacaagcaaagtctctatggtgattatgtt
tttgacaccaatcgacatgatgataataggtcagacaattttaatactggcaacatgact
gtcctttcaccatatttgaatactacagtgttacccagctcctcttcatcaagaggaagc
ttagatagttctcgttctgaaaaagatagaagtttggagagagaacgaggaattggtcta
ggcaactaccatccagcaacagaaaatccaggaacctcttcaaagcgaggtttgcagatc
tccaccactgcagcccagattgccaaagtcatggaagaagtgtcagccattcatacctct
caggaagacagaagttctgggtccaccactgaattacattgtgtgacagatgagagaaat
gcacttagaagaagctctgctgcccatacacattcaaacacttacaatttcactaagtca
gaaaattcaaataggacatgttctatgccttatgccaaattagaatacaagagatcttca
aatgatagtttaaatagtgtcagtagtagtgatggttatggtaaaagaggtcaaatgaaa
ccctcaattgaatcctattctgaagatgatgaaagtaagttttgcagttatggtcaatac
ccagccgacctagcccataaaatacatagtgcaaatcatatggatgataatgatggagaa
ctagatacaccaataaattatagtcttaaatattcagatgagcagttgaactctggaagg
caaagtccttcacagaatgaaagatgggcaagacccaaacacataatagaagatgaaata
aaacaaagtgagcaaagacaatcaaggaatcaaagtacaacttatcctgtttatactgag
agcactgatgataaacacctcaagttccaaccacattttggacagcaggaatgtgtttct
ccatacaggtcacggggagccaatggttcagaaacaaatcgagtgggttctaatcatgga
attaatcaaaatgtaagccagtctttgtgtcaagaagatgactatgaagatgataagcct
accaactatagtgaacgttactctgaagaagaacagcatgaagaagaagagagaccaaca
aattatagcataaaatataatgaagagaaacatcatgtggatcagcctattgattatagt
ttaaaatataccacagatattccttcttcacagaaacagtcattttcattctcaaagagt
tcgtctggacaaagtactaaaactgaacatatgtcttcaagcagtgagaatacatccaca
ccttcatctaatgccaagaggcagaatcagctccatccaagttctgcacagagtagaagt
ggtcagactcaaaaggctgccacttgcaaagtttcttctattaaccaagaaacaatacag
acttattgtgtagaagatactccaatatgtttttcaagatgtagttcattatcatctttg
tcatcagctgaagatgaaataggatgtggtcagacgacacaggaagcagattctgctaat
accctgcaaatagcagaaataaaagaaaagattgtaactaggtcaactgaagatcctgtg
agcgaagttccagcagtgtcgcagcacactagaaccaaatccagcagactgcagggttct
aatttatcttcagaatcagccaggcacaaagctgttgaattttcttcaggagcgaaatct
ccctccaaaagtggtgctcagacacccaaaagtccacctgaacactatgttcaggagact
ccactcatgtttagcagatgtacttctgtcagttcacttgatagttttgagagtcgttca
attgccagctccgttcagagtgaaccatgcagtggaatggtaagtggcattataagcccc
agtgatcttccagatagccctggacaaaccatgccaccaagcagaagtaaaacccctcca
ccacctcctcaaacagctcaaaccaagcgagaagtacctaaaaataaagcacctactgct
gaaaagagagagagtggacctaagcaagctgcagtaaatgctgcagttcagagggtccag
gttcttccagatgctgatactttattacattttgccacagaaagtactccagatggattt
tcttgttcatccagcctgagtgctctgagcctggatgagccgtttatacagaaagatgtg
gaattaagaataatgcctccagttcaggaaaatgacaatgggaatgaaacagaatcagag
cagcctaaagaatcaaatgaaaaccaagagaaagaggcagaaaaaactattgattctgaa
aaggacctattagatgattcagatgatgatgatattgaaatactagaagaatgtattatt
tctgccatgccaacaaagtcatcacgtaaagcaaaaaagccagcccagactgcttcaaaa
ttacctccacctgtggcaaggaaaccaagtcagctgcctgtgtacaaacttctaccatca
caaaacaggttgcaaccccaaaagcatgttagttttacaccgggagatgatatgccacgg
gtgtattgtgtagaagggacacctataaacttttccacagctacatctctaagtgatcta
acaatcgaatcccctccaaatgagttagctgttggagaaggagttagaggaggggcacag
tcaggtgaatttgaaaaacgagataccattcctacagaaggcagaagtacagatgaggct
caaggaggaaaaacctcatctgtaaccatacctgaattggatgacaataaagcagaggaa
ggtgatattcttgcagaatgcattaattccgctatgcccaaagggaaaagtcacaagcct
ttccgtgtgaaaaagataatggaccaggtccagcaagcatctgcgtcttcatctgcaccc
aacaaaaatcagttagatggtaagaaaaagaaaccaacttcaccagtaaaacctatacca
caaaatactgaatataggacacgtgtaagaaaaaatgcagactcaaaaaataatttaaat
gctgagagagttttcccagacaacaaagattcaaagaaacagaatttgaaaaataattcc
aaggacttcaatgataaggtcccaaataatgaagatagagtcagaggaagttttgctttt
gattcacctcatcattacacacctattgaaggaactccttactgtttttcacgaaatgat
tctttgagttctctagattttgatgatgatgatgttgacctttccagggaaaaggctgaa
ttaagaaaggcaaaagaaaataaggaatcagaagctaaagttaccagccacacagaacta
acctccaaccaacaatcagctaataagacacaagctattgcaaagcagccaataaatcga
ggtcagcctaaacccatacttcagaaacaatccacttttccccagtcatccaaagacata
ccagacagaggggcagcaactgatgaaaagttacagaattttgctattgaaaatactcca
gtttgcttttctcataattcctctctgagttctctcagtgacattgaccaagaaaacaac
aacaataaagaaaatgaacctgtcaaagagactgaaccccctgactcacagggagaacca
agtaaacctcaagcagcaggctatgctcctaaatcgtttcatgttgaagataccccagtt
tgtttctcaagaaacagttctctcagttctcttagtattgactctgaagatgacctgttg
caggaatgtataagctccgcaatgccaaaaaagaaaaagccttcaagactcaagggtgat
aatgaaaaacatagtcccagaaatatgggtggcatattagctgaagatctgacacttgat
ttgaaagatatacagagaccagattcagaacatggtctatcccctgattcagaaaatttt
gattggaaagctattcaggaaggtgcaaattccatagtaagtagtttacatcaagctgct
gctgctgcatgtttatctagacaagcttcgtctgattcagattccatcctttccctgaaa
tcaggaatctctctgggatcaccatttcatcttacacctgatcaagaagaaaaacccttt
acaagtaataaaggcccacgaattctaaaaccaggggagaaaagtacattggaaactaaa
aagatagaatctgaaagtaaaggaatcaaaggaggaaaaaaagtttataaaagtttgatt
actggaaaagttcgatctaattcagaaatttcaggccaaatgaaacagccccttcaagca
aacatgccttcaatctctcgaggcaggacaatgattcatattccaggagttcgaaatagc
tcctcaagtacaagtcctgtttctaaaaaaggcccaccccttaagactccagcctccaaa
agccctagtgaaggtcaaacggccaccacttctcctagaggagccaagccatctgtaaaa
tcagaattaagccctgttgccagacagacatcccaaataggtgggtcaagtaaagcacct
tctagatcaggatctagagattcaaccccttcaagacctgcccagcaaccattaagtaga
cctatgcagtctcctggccgaaactcaatttcccctggtagaaatggaataagtcctcct
aacaaattatctcaacttccaaggacatcatcccctagtactgcttcaactaagtcctca
ggttctggaaaaatgtcatatacgtctccaggtagacagatgagccaacagaaccttacc
aaacaaacaggtttatccaagaatgccagtagtattccaagaagtgagtctgcctccaaa
ggactaaatcagatgaataatggtaatggagccaataaaaaggtagaactttctagaatg
tcttcaactaaatcaagtggaagtgaatctgatagatcagaaagacctgtattagtacgc
cagtcaactttcatcaaagaagctccaagcccaaccttaagaagaaaattggaggaatct
gcttcatttgaatctctttctccatcgtctagaccagcttctcccactaggtcccaggca
caaactccagttttaagtccttcccttcctgatatgtctctatccacacattcatctgtt
caggctggtggatggcgaaaactcccacctaatctcagtcccactatagagtataatgat
ggaagaccagcaaagcgccatgatattgcacggtctcattctgaaagtccttctagactt
ccaatcaataggtcaggaacctggaaacgtgagcacagcaaacattcatcatcccttcct
cgagtaagcacttggagaagaactggaagttcatcttcaattctttctgcctcatcagaa
tccagtgaaaaagcaaaaagtgaggatgaaaaacatgtgaactctatttcaggaaccaaa
caaagtaaagaaaaccaagtatctgcaaaaggaacatggagaaaaataaaagaaaatgaa
atttctcccacaaatagtacttctcagacggtttcctcaggtgctacaaatggtgctgaa
tcaaagactctaatttatcaaatggcacctgctgtttctaaaacagaggatgtttgggtg
agaattgaggactgtcccattaacaatcctagatctggaagatctcccacaggtaatact
cccccggtgattgacagtgtttcagaaaagggaaatccaaacattaaagattcaaaagat
aatcaggcaaaacaaaatgtgggtaatggcagtgttcccatgcgtactgtgggtttggaa
aatcgcctgaactcctttattcaggtagatgcccctgaccaaaaaggaactgagacaaaa
ccaggacaaaataatcctgtccctgtatcagagactaatgaaagttctatagtggaacgt
accccattcagttctagcagctcaagcaaacacagttcacctagtgggactgttgctgcc
agagtgactccttttaattacaacccaagccctaggaaaagcagcgcagatagcacttca
gctcggccatctcagatcccaactccagtgaataacaacacaaagaagcgagattccaaa
actgacagcacagaatccagtggaacccaaagtcctaagcgccattctgggtcttacctt
gtgacatccgtttaa

KEGG   Pongo abelii (Sumatran orangutan): 100435472
Entry
100435472         CDS       T01416                                 

Gene name
APC2
Definition
(RefSeq) adenomatous polyposis coli protein 2 isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100435472 (APC2)
   04390 Hippo signaling pathway
    100435472 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100435472 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100435472 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100435472 (APC2)
   05206 MicroRNAs in cancer
    100435472 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100435472 (APC2)
   05225 Hepatocellular carcinoma
    100435472 (APC2)
   05226 Gastric cancer
    100435472 (APC2)
   05217 Basal cell carcinoma
    100435472 (APC2)
   05213 Endometrial cancer
    100435472 (APC2)
   05224 Breast cancer
    100435472 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100435472 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    100435472 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100435472 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100435472 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100435472 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100435472 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100435472 (APC2)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100435472 (APC2)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100435472 (APC2)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100435472 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm_APC_u3 Arm Suppressor_APC SAMP bZIP_1 HALZ APG6_N
Other DBs
NCBI-GeneID: 100435472
NCBI-ProteinID: XP_024092549
Ensembl: ENSPPYG00000009318
LinkDB
Position
19
AA seq 2331 aa
MGLLGLLSLLHSAFFGDQTLQELKMASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHL
SKLETETSGMKEVLKHLQGKLEQEARVLVSSGQTEVLEQLKALQMEITSLYNLKFQPPTL
GPEPAARTPEGSPVHGSGPSKDSFGELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYY
SQLQGLSKRLDELPHVETQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRA
SRLEQIDKELLEAQDRVQQTEPQALLAVKSVPVDEDPETEVPTHPEDGTPQPGNSKVEVV
FWLLSMLATRDQEDTARTLLAMSSSPESCVAMRRSGCLPLLLQILHGTEAVAGGRAGAPG
APGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDGGPE
GGGAGGAPIPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRD
PLNLALRRYAGMTLTNLTFGDVANKATLCARRGCMEAIVAQLASDSEELHQVVSSILRNL
SWRADINSKKVLREAGSVTALVQCVLRATKESTLKSVLSALWNLSAHSTENKAAICQVDG
ALGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTS
HSLTIVSNACGTLWNLSARSARDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLA
HRPAKHQAAATAVSPGSCVPSLYVRKQRALEAELDARHLAQALEHLEKQGPPAAEAATKK
PLPPLRHLDGLAQDYASDSGCFDDDDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQAL
ARTLPTRRGGKEAEKDTSGEAAVAAKAKAKLALAVARIDQLVEDISALHTSSDDSFSLSS
GDPGQEAPREGRAQSCSPCRGPEGGRREAGSRAHPLLRLKAANASLSNDSLNSGSASDGY
CPREHMLPCPLAALASRREDPRCGQPRPSRLDLDLPGGQAEPPAREATSADARVRTIKLS
PTYQHVPLLEGASRAGAELLAGPGTSPGARKQAWLPADHLSKVPEKLAAAPLSVASKALQ
KLVAQEGPLSLSRCSSLSSLSSAGRPGPSEGGDLDDSDSSLEGLEEAGPGEAELDSAWRA
PGATSLPVAIPAPRRNRGRGLGVEDATPSSSSENYVQETPLVLSRCSSVSSLGSFESPSI
ASSIPSDPCSGQGSGTISPSELPDSPGQTMPPSRSKTPPLAPAPQGPPEASQFSLQWESY
VKRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCASSLSALALHEHYVQQDVELRL
LPSACPERGGGAGGAGLHFAGHRRREEGPAPTGSRPRGAADQELELLRECLGAAVPARLR
KVASALVPGRRALPVPVYMLVPAPAPAPAQEDDSCTDSAEGTPVNFSSAASLSDETLQGP
PRDQPGGPAGRQRSTGRPTSARQAMGHRHKAGGAGRSTEQSRGAGKNPAGLELPLGRSPS
APADKDGSKPGRTRGDGALQSLCLTTPTEEAVYCFYGNDSDEEPPAAAPTPTHRRTSAIP
RAFTRERPQGRKEAPAPSKAAPAAPPPAWTQPSLIADETPPCYSLSSSASSLSEPEPSEP
PAVHPRGREPAVTKDPGPGGGRDSSPSPRAAEELLQRCISSALPRRRPPVSGLRRRKPRA
TRLDERPAEGSRERGEEAAGSDRASDLDSVEWRAIQEGANSIVTWLHQAAAATREASSES
DSILSFVSGLSLGSTLQPPKHRKGRQAEGEMGSARRPEKRGATSAKTSGSPRSPAGPEKP
RGTQKTTPGVPAVLRGRTVIYVPSPAPRAQPKGTPGPRATPRKVAPPCLAQPAAPAKVPS
PGQQRSRSLHRPGKTSELATLSQPPRSATPPARLAKTPSSSSSQTSPASQPLPRKRPPVT
QAAGPLPGPGASPVPKTPARTLLAKQHKTQRSPVRIPFMQRPARRGPPPLARAVPESGPR
GRAGTEAGPGARGGRLGLVRVASALSSGSESSDRSGFRRQLTFIKESPGLRRRRSELSSA
ESAASAPQGAPPRRGRPALPAVFLCSSRCEELRAAPRQAPAPAPARQRPPAARPGPGERP
ARRTSSESPSRLPVRAPAARPETVKRYASLPHISVARRPDGAVPAAPAPADAARRSSDGE
PRPLPRVAAPGTTWRRIRDEDVPHILRSTLPATALPLRGSMPEDALAGPAPRKTSDAVVQ
TEEVAAPKTNSSTSPSLEIREPPGAPVGGQLSLLGSDVDGPSLAKAPISAPFVHEGLGVA
VGGFPASRHGSPSRSARVPPFNYVPSPMVVAATTDSAAEKAPATASATLLE
NT seq 6996 nt   +upstreamnt  +downstreamnt
atggggctcctggggctcctgagcctgctgcactcggccttcttcggggaccagacgctg
caggagctgaagatggcgagctccgtggcgccctacgagcagctggtgcggcaggtggag
gccttgaaggctgagaacagccacctgaggcaggagctaagggacaactccagccacctg
tccaagctggagacagagacgtcgggcatgaaggaggtcctgaagcacctacagggaaaa
ctggagcaggaggcccgagtgctggtgtcctcggggcagacggaggtgctggagcagctg
aaggccctacagatggaaattaccagcctgtacaacctcaagttccagccgcccaccctg
ggcccggagcctgccgcccggaccccggagggcagcccagtacatggctccgggccctcc
aaggacagctttggggagctgagccgggccaccatccggctgctggaagaactggaccgg
gaacggtgtttcctgctgaatgagattgagaaggaggagaaggagaagctctggtactac
tctcagctgcagggcctgtccaagcgccttgacgagctgccgcacgtggagacgcagttc
tcgatgcagatggacctgatccggcagcagcttgagttcgaggcccagcacatccgctct
ctgatggaggagcgcttcggcacctcggacgagatggtgcagcgggcccagatccgcgct
tcgcgcctggagcagattgacaaggagctgctggaggcgcaggaccgagtgcagcagacg
gagccccaggccttgctggcggtgaagtcggtgccggtggacgaggaccccgagacagag
gtccccacacaccctgaggatggcacccctcagccgggcaacagcaaggtggaggtggtc
ttctggctgttgtcgatgttggctacgcgtgaccaggaggatacagcgcgcacgctgctg
gccatgtccagctcgcccgagagctgcgtggccatgcgccgctcgggctgtctgcctctg
ctgctgcaaatcctccacggcaccgaggctgtggccgggggtcgcgccggggccccagga
gcaccgggcgccaaggacgcacgcatgcgcgccaacgcggcgctgcacaacatcgtcttc
tcgcagccggaccagggcctggcgcgcaaggagatgcgcgtcctgcacgtgctggagcag
atccgggcctactgcgagacctgctgggactggttgcaggcccgagacggcgggcccgag
ggaggcggcgccggcggcgccccgatccccatcgagccgcagatctgccaggccacctgt
gctgttatgaagctgtcctttgacgaggagtaccgccgtgccatgaacgagctaggtggg
ctgcaggccgtggcagagctgctgcaggttgactacgagatgcacaagatgacccgggac
ccgctgaacctggcgctgcgccgctatgcgggcatgaccctcaccaacctcacctttggg
gacgttgccaacaaggccaccttgtgtgcgcgccgcggctgcatggaggccatcgtggcc
cagctggcctccgacagtgaggagctccaccaggtggtgtccagcatccttcggaacttg
tcctggagggccgacatcaacagcaagaaggtgctgagggaggcgggcagcgtgactgcc
ctggtgcagtgtgtcctgcgggccaccaaggagtccaccctgaagagcgtgctgagcgcc
ctgtggaatctgtctgcacacagcacagagaacaaggcggccatctgccaggtggatggc
gccctgggcttcctggtgagcaccctgacctacaagtgccagagcaactcgctggccatc
atcgagagtggcggcggcatcctccgcaacgtgtccagcctcatcgccacccgtgaggac
tacaggcaggtgctccgggatcacaactgtctgcagacgctgctgcagcatctgacttcg
cacagcctgaccatagtgagcaacgcgtgcggcacgctctggaacctgtcggcccgcagt
gcccgtgaccaggagctgctgtgggacctgggcgccgtgggcatgctgcgtaatctggtg
cactccaagcacaagatgatcgccatgggcagcgccgccgccctgcgcaacctgctggcc
catcggcccgccaagcaccaggcggccgccaccgccgtgtccccaggcagctgcgtgccc
agcctgtacgtgcgcaagcagcgggctctggaggccgagctggacgcacggcacctcgcg
caggcgctggagcacctggagaagcagggcccgccggcagccgaggccgccactaagaag
ccgctgccgcccctgcgacacctggacggcctggcccaagactatgcttccgattcgggc
tgctttgacgacgacgatgcaccgtcatccctggctgcggccgcggccaccggggagcca
gccagccctgccgcgctgtccctcttcctgggcagccccttcctgcaggggcaagctctg
gctcgcaccctgcccacccgccgaggcggcaaggaggcggagaaggacaccagtggggag
gcagccgtggcggccaaggccaaggccaagctggcgcttgcagtggcgcgcatcgaccag
ctggtggaggacatctccgccctgcacacctcgtccgacgatagcttcagcctcagctct
ggagacccggggcaggaggcgccacgggagggccgcgcccagtcttgctcgccatgccgc
ggcccagagggcgggcggcgagaggcaggaagccgggcgcacccgctgctgcggctcaag
gcggccaacgccagcctctccaacgacagcctcaacagcggcagtgccagcgacgggtac
tgcccacgcgaacatatgctgccctgcccgctggccgcactggcttcgcgccgcgaggac
cccaggtgtgggcagcctcggcccagccggcttgatcttgacctgccgggcggccaggcc
gagcccccggcccgcgaggccacatccgccgacgcccgcgtgcgcaccatcaagctgtcg
cctacctatcagcacgtgccactgctcgagggtgcctcaagggcgggtgcagagctcctc
gcggggcctggaacctctccaggggcccggaagcaggcctggctgccggccgaccacctg
agcaaggttcccgagaagctggcggccgccccgctgtccgtggccagcaaggcactgcag
aaactggtggcgcaagaggggccgctctcgctgtcccgatgcagctccctttcctcgctg
tcctcggccggccgcccaggccccagcgagggcggtgacctggatgacagtgactcctcc
ttggaggggctggaggaggccggcccaggcgaggctgagctggacagcgcgtggcgggcg
cccggggccacctcgctgcccgtagccattccggctccccggcgtaaccgaggccggggc
ctcggggtggaagacgccacgccgtccagctcgtcggagaactacgtgcaggagacaccg
cttgtgctgagccgctgcagctctgtgagctcgctgggcagcttcgagagcccgtccatc
gccagctccatccccagtgacccttgcagcgggcagggcagcggcaccatcagccctagt
gagctgcctgacagccccgggcagaccatgcctcccagccggagcaagacgccgccgctg
gcgcccgcgccacagggtccccccgaggccagccagttcagcctgcagtgggagagctac
gtgaagcgcttcctggacatcgccgactgccgggagcgctgccggctgccatctgagttg
gacgcaggcagcgtgcgctttacggtggagaagccagacgagaacttctcgtgcgcctcc
agcctcagcgcgctggccttacacgagcactacgtgcagcaggacgtggagctgcggctg
ctgccctcggcctgcccggagcgcggcgggggcgctgggggcgccggcctccactttgca
gggcaccggcggcgggaggaggggccggcgcccacgggttctcgcccccgcggcgccgcg
gaccaggagctggaactgctgcgggagtgcctgggagccgccgtgcctgcccggctgcgc
aaggtggcctccgcgctggtgccaggtcgccgcgcactccccgtgcccgtctacatgttg
gtgccggccccggccccggccccggcccaggaggacgactcctgcactgactccgcggag
ggcacgccggtcaacttctccagcgccgcctcgctcagcgacgagacgctgcagggaccc
cccagggaccagcccgggggaccagcgggtaggcaaagatccaccggccgccccacctct
gccaggcaggccatggggcaccggcacaaggcgggaggcgccggccgcagcacagagcag
tctcggggcgcgggcaagaacccagcagggctggagctgcccctgggccggtctccgagc
gcccccgcagacaaggacggctcaaagcccggccggactcgcggggacggggcgctccag
tcgctgtgcctcacgacgcccaccgaggaggccgtgtactgcttctacggcaacgactcg
gacgaggagcccccggcggccgcgcccacgcccacccaccggcgcacatcggccatcccc
cgcgcttttacgcgggagcgcccgcagggccggaaggaggcccctgccccatccaaggcc
gcaccagccgccccgccgcccgcctggacccagcccagcctcattgctgacgagaccccg
ccctgctactccctgagctcctccgccagctccctcagcgagcccgagccctcagagccg
ccggccgtccatccacgaggccgggagcccgcggtcaccaaggacccaggcccaggaggc
ggacgcgacagctcacccagtccgcgggccgcggaggagcttctgcagcggtgcatcagc
tcggccctgcccaggcgccggccccccgtgtctggcctgcggcgccgcaagccccgagcc
acccggctggatgagcggcccgcggaggggtcccgggaacgcggcgaggaggcagcgggc
tcggaccgggcctccgacctggatagcgtggagtggcgcgccatccaggagggcgccaat
tcaatcgtcacgtggctgcaccaggcagcagctgccacgcgggaggcctcctccgagtcc
gactccatcctgtccttcgtatccgggctgtcgttggggtccaccctacagccccccaag
cacaggaagggacgacaggcggagggagaaatgggcagtgctcggcggccagagaaaagg
ggcgcaacctcagccaagaccagcgggagcccccgttcccctgcaggccccgagaagcca
cgtggcacacagaagaccacgcccggggtgccagctgtgcttcggggacgaacagtgatc
tacgtgcccagcccggcaccccgtgcccagcccaaagggacccccggcccccgcgccaca
ccgcggaaggtggcgcccccttgcctggcacagcccgcggctccagccaaagtccccagc
cccggacagcagcggtcgcggagcctacaccggcctggcaagacctcggagctggcgacg
ctgagccagccccccagaagcgccacaccgcccgcccgcctcgccaagaccccctcctcc
agctcctcccagacctcgcccgcctcccagcccctgcccagaaagcgccccccggtcacc
caggctgcagggcccctgcccggccccggggcctccccggtgcccaagacgccggcgcgc
acccttctggcgaagcagcacaagacgcagagatcgcccgtgcggatcccgttcatgcag
aggccggcccggcgtgggccgccaccgctggctcgggcagtcccggagtcgggccccagg
ggccgggcggggaccgaggcgggcccgggggcgcgcgggggccgcctgggcctggtgcgt
gtggcctcagccctctccagcggcagcgagtcctccgaccgctcgggcttccggcgacag
ctgaccttcatcaaggagtcgccgggcttgcggcgccgccgctccgagctgtcctcggcc
gagtccgcggcctctgccccccagggcgccccgccccgccgcggccggcccgcgctgccc
gccgtcttcctctgctcctcacgctgcgaagagctccgagcggcaccccggcaggccccg
gccccggccccggcccggcagcggccccccgcggcccgacccggccctggcgagcgccct
gcccggcgcaccagctccgagagcccgtcccgcctgcccgtgcgcgcgcccgccgcccgg
ccggagactgtcaagcgctacgcgtcgctgccgcacatcagcgtggcccgcaggcccgac
ggcgccgtccccgcggcccctgccccagccgacgccgcgcgccgcagcagcgacggggag
ccccggccgctccccagggtggccgcgccgggcacgacgtggcggcgcatccgagatgag
gacgtgccccatatcctgcgcagcacgctgcccgccacggccctgccactgcggggctcc
atgcccgaggacgccctggccgggcccgcgccgcgcaagaccagcgacgccgtggtccag
accgaggaggtcgccgcccccaagaccaactccagcacgtccccgagcctggagatcagg
gagccccccggggcccccgtcggcggccagctctcccttctcggcagcgacgtggacggt
cccagcctcgccaaggctcccatctccgcacccttcgtgcacgagggcctgggggtcgcc
gtggggggcttccccgccagccggcacggctcccccagccgctcggcccgagtacccccc
ttcaactatgtgcccagccccatggtggtcgcagccaccaccgactcggccgcggagaaa
gccccggccactgcctccgccaccctcctggaatag

DBGET integrated database retrieval system