KEGG   Pongo abelii (Sumatran orangutan): 100431483
Entry
100431483         CDS       T01416                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04613  Neutrophil extracellular trap formation
pon04650  Natural killer cell mediated cytotoxicity
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05020  Prion disease
pon05135  Yersinia infection
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
pon05416  Viral myocarditis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431483 (RAC2)
   04014 Ras signaling pathway
    100431483 (RAC2)
   04015 Rap1 signaling pathway
    100431483 (RAC2)
   04310 Wnt signaling pathway
    100431483 (RAC2)
   04370 VEGF signaling pathway
    100431483 (RAC2)
   04071 Sphingolipid signaling pathway
    100431483 (RAC2)
   04024 cAMP signaling pathway
    100431483 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100431483 (RAC2)
   04520 Adherens junction
    100431483 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100431483 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100431483 (RAC2)
   04650 Natural killer cell mediated cytotoxicity
    100431483 (RAC2)
   04662 B cell receptor signaling pathway
    100431483 (RAC2)
   04664 Fc epsilon RI signaling pathway
    100431483 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    100431483 (RAC2)
   04670 Leukocyte transendothelial migration
    100431483 (RAC2)
   04062 Chemokine signaling pathway
    100431483 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    100431483 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431483 (RAC2)
   05231 Choline metabolism in cancer
    100431483 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100431483 (RAC2)
   05212 Pancreatic cancer
    100431483 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    100431483 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100431483 (RAC2)
   05416 Viral myocarditis
    100431483 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100431483 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100431483 (RAC2)
   05163 Human cytomegalovirus infection
    100431483 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100431483 (RAC2)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100431483 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 100431483
NCBI-ProteinID: XP_002831136
Ensembl: ENSPPYG00000011791
UniProt: H2P4A5 A0A6D2W2B4
LinkDB
Position
22
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRTCSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaaatgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaatgcctttcccggagagtacatccccaccgtgtttgacaactat
tcagccaacgtgatggtggacagcaagccagtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccgctctcctacccacagacggatgtcttcctcatc
tgcttctccctcgtcagcccagcctcttatgagaacgtccgcgccaagtggttcccggaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatacctggagtgctcagccctc
acccagagaggcctgaaaactgtgttcgacgaggccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcacctgcagcctcctctag

KEGG   Pongo abelii (Sumatran orangutan): 100443271
Entry
100443271         CDS       T01416                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04972  Pancreatic secretion
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
pon05416  Viral myocarditis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100443271 (RAC1)
   04014 Ras signaling pathway
    100443271 (RAC1)
   04015 Rap1 signaling pathway
    100443271 (RAC1)
   04310 Wnt signaling pathway
    100443271 (RAC1)
   04370 VEGF signaling pathway
    100443271 (RAC1)
   04071 Sphingolipid signaling pathway
    100443271 (RAC1)
   04024 cAMP signaling pathway
    100443271 (RAC1)
   04151 PI3K-Akt signaling pathway
    100443271 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100443271 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100443271 (RAC1)
   04520 Adherens junction
    100443271 (RAC1)
   04530 Tight junction
    100443271 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100443271 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100443271 (RAC1)
   04620 Toll-like receptor signaling pathway
    100443271 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    100443271 (RAC1)
   04662 B cell receptor signaling pathway
    100443271 (RAC1)
   04664 Fc epsilon RI signaling pathway
    100443271 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    100443271 (RAC1)
   04670 Leukocyte transendothelial migration
    100443271 (RAC1)
   04062 Chemokine signaling pathway
    100443271 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    100443271 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100443271 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    100443271 (RAC1)
   04380 Osteoclast differentiation
    100443271 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100443271 (RAC1)
   05205 Proteoglycans in cancer
    100443271 (RAC1)
   05203 Viral carcinogenesis
    100443271 (RAC1)
   05231 Choline metabolism in cancer
    100443271 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100443271 (RAC1)
   05212 Pancreatic cancer
    100443271 (RAC1)
   05211 Renal cell carcinoma
    100443271 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100443271 (RAC1)
   05020 Prion disease
    100443271 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    100443271 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100443271 (RAC1)
   05416 Viral myocarditis
    100443271 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100443271 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100443271 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100443271 (RAC1)
   05135 Yersinia infection
    100443271 (RAC1)
   05100 Bacterial invasion of epithelial cells
    100443271 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100443271 (RAC1)
   05163 Human cytomegalovirus infection
    100443271 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100443271 (RAC1)
   05169 Epstein-Barr virus infection
    100443271 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100443271 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100443271 (RAC1)
   04031 GTP-binding proteins [BR:pon04031]
    100443271 (RAC1)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100443271 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100443271 (RAC1)
  Macropinocytosis
   Ras GTPases
    100443271 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100443271 (RAC1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100443271 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   100443271 (RAC1)
  Exosomal proteins of colorectal cancer cells
   100443271 (RAC1)
  Exosomal proteins of bladder cancer cells
   100443271 (RAC1)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100443271 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 100443271
NCBI-ProteinID: XP_024105803
LinkDB
Position
7
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatccg
cagggtctagccatggctaaggagattggtgctgtaaaatacctggagtgctcagcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccacct
cccgtgaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Pongo abelii (Sumatran orangutan): 112129584
Entry
112129584         CDS       T01416                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 isoform X1
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04650  Natural killer cell mediated cytotoxicity
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
pon05416  Viral myocarditis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112129584 (RAC3)
   04014 Ras signaling pathway
    112129584 (RAC3)
   04015 Rap1 signaling pathway
    112129584 (RAC3)
   04310 Wnt signaling pathway
    112129584 (RAC3)
   04370 VEGF signaling pathway
    112129584 (RAC3)
   04071 Sphingolipid signaling pathway
    112129584 (RAC3)
   04024 cAMP signaling pathway
    112129584 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112129584 (RAC3)
   04520 Adherens junction
    112129584 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112129584 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112129584 (RAC3)
   04662 B cell receptor signaling pathway
    112129584 (RAC3)
   04664 Fc epsilon RI signaling pathway
    112129584 (RAC3)
   04062 Chemokine signaling pathway
    112129584 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    112129584 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112129584 (RAC3)
   05231 Choline metabolism in cancer
    112129584 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112129584 (RAC3)
   05212 Pancreatic cancer
    112129584 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112129584 (RAC3)
   05416 Viral myocarditis
    112129584 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112129584 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112129584 (RAC3)
   05163 Human cytomegalovirus infection
    112129584 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    112129584 (RAC3)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112129584 (RAC3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 112129584
NCBI-ProteinID: XP_024090288
LinkDB
Position
17
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPQTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgacggcgccgtggggaagacatgcttgctg
atcagctacacgaccaacgccttccccggagagtacatccccaccgtttttgacaactat
tctgccaacgtgatggtggacgggaaaccggtcaacctggggctgtgggacacggcgggt
caggaggactacgatcggctgcggccactctcctatccccagactgatgtctttctgatc
tgcttctccctggtgagccccgcctcctttgagaacgttcgtgccaagtggtacccggag
gtgcggcaccactgcccccagacgcccatcctcctggtgggcaccaagctggacctccgc
gacgacaaggacaccattgagcggctgcgggacaagaagctggcgcccatcacctaccca
cagggcctggccatggcccgggagatcggctctgtgaaatacctggagtgctcagccctg
acccagcggggcctgaagacagtgtttgacgaggcaatccgcgcggtgctctgcccgccc
cccgtgaagaagccggggaagaagtgcactgtcttctag

DBGET integrated database retrieval system