KEGG   Pongo abelii (Sumatran orangutan): 100431520
Entry
100431520         CDS       T01416                                 

Definition
(RefSeq) immunoglobulin delta heavy chain-like
  KO
K06856  immunoglobulin heavy chain
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04064  NF-kappa B signaling pathway
pon04072  Phospholipase D signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon04650  Natural killer cell mediated cytotoxicity
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04672  Intestinal immune network for IgA production
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05150  Staphylococcus aureus infection
pon05152  Tuberculosis
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05202  Transcriptional misregulation in cancer
pon05310  Asthma
pon05320  Autoimmune thyroid disease
pon05322  Systemic lupus erythematosus
pon05323  Rheumatoid arthritis
pon05330  Allograft rejection
pon05340  Primary immunodeficiency
pon05414  Dilated cardiomyopathy
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100431520
   04020 Calcium signaling pathway
    100431520
   04072 Phospholipase D signaling pathway
    100431520
   04151 PI3K-Akt signaling pathway
    100431520
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100431520
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100431520
   04650 Natural killer cell mediated cytotoxicity
    100431520
   04662 B cell receptor signaling pathway
    100431520
   04664 Fc epsilon RI signaling pathway
    100431520
   04666 Fc gamma R-mediated phagocytosis
    100431520
   04672 Intestinal immune network for IgA production
    100431520
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100431520
  09163 Immune disease
   05310 Asthma
    100431520
   05322 Systemic lupus erythematosus
    100431520
   05323 Rheumatoid arthritis
    100431520
   05320 Autoimmune thyroid disease
    100431520
   05330 Allograft rejection
    100431520
   05340 Primary immunodeficiency
    100431520
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100431520
   05416 Viral myocarditis
    100431520
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100431520
   05150 Staphylococcus aureus infection
    100431520
   05152 Tuberculosis
    100431520
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100431520
   05169 Epstein-Barr virus infection
    100431520
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100431520
   05140 Leishmaniasis
    100431520
   05143 African trypanosomiasis
    100431520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100431520
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100431520
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 100431520
NCBI-ProteinID: XP_024087189
LinkDB
Position
14
AA seq 243 aa
MDWIWRILFLVAAATGAHSQVQLGQSGPEVKKPESSVKVSCKASGYTFTSSAMQWVRQAP
GQGLEWIGWIIVGSGNTNYAQKFQGRVTITRDTSTSTAYMELSSLRSEDTAVYYCAADTD
TRVRSEPPGCAHDTRGCSEPPGGGRDTRGCLQQQGTLRTTRWPLGHQGVFGTTRGCSEPT
WGVQDTRRHSEPRGSDQDNRGCSGPPGGAQDTKEHSEAPGGTQDTREGGTENHQGVLRTS
VSS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggactggatttggaggatcctcttcttggtggcagcagcgactggtgcccactcccag
gtccagctggggcagtctgggcctgaggtgaagaagcctgagtcctcagtgaaggtctcc
tgcaaggcttctggatacacctttactagctctgctatgcagtgggtgcgacaggctcct
ggacaaggccttgagtggataggatggatcatcgttggcagtggtaacacaaactatgca
cagaagttccagggaagagtcaccattaccagggacacgtccacgagcacagcctacatg
gagctgagcagcctgagatccgaggacacggccgtgtattactgtgcggcagacacagac
accagggtgcgctcagaaccaccagggtgcgctcatgacaccagggggtgctcagaacca
ccggggggtggtcgggacaccagagggtgcttacaacaacaggggacgctcagaaccacc
aggtggcccttaggacaccagggggtgttcggaaccaccagggggtgctcagaaccaaca
tggggcgttcaggacaccaggagacactcagaaccaagagggagcgatcaggacaacagg
ggttgctcaggaccaccagggggagctcaggacaccaaggagcactcagaagcaccaggg
ggcactcaggacaccagagaggggggcactgagaaccaccaaggggtgctcaggacatca
gtgtcctcttag

KEGG   Pongo abelii (Sumatran orangutan): 100939054
Entry
100939054         CDS       T01416                                 

Definition
(RefSeq) immunoglobulin alpha-2 heavy chain-like
  KO
K06856  immunoglobulin heavy chain
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04064  NF-kappa B signaling pathway
pon04072  Phospholipase D signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon04650  Natural killer cell mediated cytotoxicity
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04672  Intestinal immune network for IgA production
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05150  Staphylococcus aureus infection
pon05152  Tuberculosis
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05202  Transcriptional misregulation in cancer
pon05310  Asthma
pon05320  Autoimmune thyroid disease
pon05322  Systemic lupus erythematosus
pon05323  Rheumatoid arthritis
pon05330  Allograft rejection
pon05340  Primary immunodeficiency
pon05414  Dilated cardiomyopathy
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100939054
   04020 Calcium signaling pathway
    100939054
   04072 Phospholipase D signaling pathway
    100939054
   04151 PI3K-Akt signaling pathway
    100939054
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100939054
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100939054
   04650 Natural killer cell mediated cytotoxicity
    100939054
   04662 B cell receptor signaling pathway
    100939054
   04664 Fc epsilon RI signaling pathway
    100939054
   04666 Fc gamma R-mediated phagocytosis
    100939054
   04672 Intestinal immune network for IgA production
    100939054
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100939054
  09163 Immune disease
   05310 Asthma
    100939054
   05322 Systemic lupus erythematosus
    100939054
   05323 Rheumatoid arthritis
    100939054
   05320 Autoimmune thyroid disease
    100939054
   05330 Allograft rejection
    100939054
   05340 Primary immunodeficiency
    100939054
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100939054
   05416 Viral myocarditis
    100939054
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100939054
   05150 Staphylococcus aureus infection
    100939054
   05152 Tuberculosis
    100939054
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100939054
   05169 Epstein-Barr virus infection
    100939054
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100939054
   05140 Leishmaniasis
    100939054
   05143 African trypanosomiasis
    100939054
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100939054
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100939054
SSDB
Motif
Pfam: V-set Ig_3 PG_isomerase_N zf-Mss51
Other DBs
NCBI-GeneID: 100939054
NCBI-ProteinID: XP_024087185
LinkDB
Position
14
AA seq 236 aa
MGWTCKILFLVAAATGAHSQVQLVQSGAEMKKPGSSVKVSCKASGYTFTYCYLHWVRQAT
GKGLEWVSYISGDSSYTSYADSVKGRFTISRDNAKNSLYLQMNSLRVEDTAVYYCVKHTG
GVASATKYLPHEYANALASTEVNTDLSLPREHHTTTASLPSEAPRAQHLTMDCTWRILLL
VAAATGAHSQVQPVQSGAEVRKPGSSVKVSCKVSRSTFTFHYMHWVRQAPGKQTIS
NT seq 711 nt   +upstreamnt  +downstreamnt
atgggctggacctgcaagatcctcttcttggtggcagcagccacaggtgcccactcccag
gtgcagctggtgcaatctggggctgagatgaagaagcctgggtcctcagtgaaggtctcc
tgcaaggcttctggatacaccttcacttactgctacttgcactgggtgcgacaggctaca
gggaagggactggagtgggtttcatacattagtggtgatagtagttacacaagctacgca
gactctgtgaagggccgattcaccatctccagggacaacgccaagaactcactgtatctg
caaatgaacagcctgagagtcgaggacacggctgtgtattactgtgtgaaacacacaggt
ggggtggcttcagctacgaaatacctgcctcatgaatatgcaaatgcactggcatctacc
gaggtaaatacagatctgtccttgcccagagagcatcacacaacaaccgcatccctcccc
tcagaagcccccagagcacagcacctcaccatggactgcacctggaggattctcctcttg
gtggcagcagctacaggtgcccactcccaggtgcagccggtgcagtctggagctgaggtg
aggaaacctgggtcctcagtgaaggtctcctgcaaagtttccagatccaccttcaccttc
cactacatgcactgggtgcgacaggcccctggaaaacaaactatctcttga

KEGG   Pongo abelii (Sumatran orangutan): 100939231
Entry
100939231         CDS       T01416                                 

Definition
(RefSeq) uncharacterized protein LOC100939231
  KO
K06856  immunoglobulin heavy chain
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04064  NF-kappa B signaling pathway
pon04072  Phospholipase D signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon04650  Natural killer cell mediated cytotoxicity
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04672  Intestinal immune network for IgA production
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05150  Staphylococcus aureus infection
pon05152  Tuberculosis
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05202  Transcriptional misregulation in cancer
pon05310  Asthma
pon05320  Autoimmune thyroid disease
pon05322  Systemic lupus erythematosus
pon05323  Rheumatoid arthritis
pon05330  Allograft rejection
pon05340  Primary immunodeficiency
pon05414  Dilated cardiomyopathy
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100939231
   04020 Calcium signaling pathway
    100939231
   04072 Phospholipase D signaling pathway
    100939231
   04151 PI3K-Akt signaling pathway
    100939231
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100939231
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100939231
   04650 Natural killer cell mediated cytotoxicity
    100939231
   04662 B cell receptor signaling pathway
    100939231
   04664 Fc epsilon RI signaling pathway
    100939231
   04666 Fc gamma R-mediated phagocytosis
    100939231
   04672 Intestinal immune network for IgA production
    100939231
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100939231
  09163 Immune disease
   05310 Asthma
    100939231
   05322 Systemic lupus erythematosus
    100939231
   05323 Rheumatoid arthritis
    100939231
   05320 Autoimmune thyroid disease
    100939231
   05330 Allograft rejection
    100939231
   05340 Primary immunodeficiency
    100939231
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100939231
   05416 Viral myocarditis
    100939231
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100939231
   05150 Staphylococcus aureus infection
    100939231
   05152 Tuberculosis
    100939231
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100939231
   05169 Epstein-Barr virus infection
    100939231
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100939231
   05140 Leishmaniasis
    100939231
   05143 African trypanosomiasis
    100939231
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100939231
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100939231
SSDB
Motif
Pfam: V-set Ig_3 ig
Other DBs
NCBI-GeneID: 100939231
NCBI-ProteinID: XP_024087190
LinkDB
Position
14
AA seq 245 aa
MELGLSWVFLVAILEGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAP
GKGLEWVSYISGDSSYINYADSVKGRFTISRDNAKNSLYLRMNSLRAEDTAVYYCAQVTL
KESGPALVKPTQTLTLTCTFSGFSLSTSGVGVGWIRQPPGKALEWLASIDWDDDKYYSPS
LKSRLTISKDTSKNQVVITMTNMDPVDTATYYCARIPQRHSPGLLLYKNPGCFSVVLPPH
LCRTG
NT seq 738 nt   +upstreamnt  +downstreamnt
atggaattggggctgagctgggttttccttgttgccattttagaaggtgtccagtgtgag
gtgcagctggtggagtctgggggaggcttggtacagcctgggggttccctgagactctcc
tgtgcagcctctggattcacattcagtagctatggcatgaactgggtccgccaggctcca
gggaaggggctggagtgggtttcatacattagtggtgacagtagttacataaactacgca
gactctgtgaagggccgattcaccatctccagagacaacgccaagaactcattgtatctg
cgaatgaacagcctgagagccgaggacacggctgtttattactgtgcccaggtcaccttg
aaggagtctggtcctgcgttggtgaaacccacacagaccctcacgctgacctgcaccttc
tctgggttctcactcagcactagtggagtgggtgtgggctggatccgtcagcccccaggg
aaggccctggagtggcttgcaagcattgattgggatgatgataaatactacagcccatct
ctgaagagcaggctcaccatctccaaggacacctccaaaaaccaggtggtcattacaatg
accaacatggaccctgtggacacagccacatattactgtgcacggataccacagagacac
agcccagggctcctcctgtacaagaacccaggctgcttctcagtggtgctccctccccac
ctctgcagaacaggatag

KEGG   Pongo abelii (Sumatran orangutan): 100939294
Entry
100939294         CDS       T01416                                 

Definition
(RefSeq) uncharacterized protein LOC100939294
  KO
K06856  immunoglobulin heavy chain
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04064  NF-kappa B signaling pathway
pon04072  Phospholipase D signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon04650  Natural killer cell mediated cytotoxicity
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04672  Intestinal immune network for IgA production
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05150  Staphylococcus aureus infection
pon05152  Tuberculosis
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05202  Transcriptional misregulation in cancer
pon05310  Asthma
pon05320  Autoimmune thyroid disease
pon05322  Systemic lupus erythematosus
pon05323  Rheumatoid arthritis
pon05330  Allograft rejection
pon05340  Primary immunodeficiency
pon05414  Dilated cardiomyopathy
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100939294
   04020 Calcium signaling pathway
    100939294
   04072 Phospholipase D signaling pathway
    100939294
   04151 PI3K-Akt signaling pathway
    100939294
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100939294
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100939294
   04650 Natural killer cell mediated cytotoxicity
    100939294
   04662 B cell receptor signaling pathway
    100939294
   04664 Fc epsilon RI signaling pathway
    100939294
   04666 Fc gamma R-mediated phagocytosis
    100939294
   04672 Intestinal immune network for IgA production
    100939294
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100939294
  09163 Immune disease
   05310 Asthma
    100939294
   05322 Systemic lupus erythematosus
    100939294
   05323 Rheumatoid arthritis
    100939294
   05320 Autoimmune thyroid disease
    100939294
   05330 Allograft rejection
    100939294
   05340 Primary immunodeficiency
    100939294
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100939294
   05416 Viral myocarditis
    100939294
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100939294
   05150 Staphylococcus aureus infection
    100939294
   05152 Tuberculosis
    100939294
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100939294
   05169 Epstein-Barr virus infection
    100939294
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100939294
   05140 Leishmaniasis
    100939294
   05143 African trypanosomiasis
    100939294
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100939294
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100939294
SSDB
Motif
Pfam: V-set ig Ig_3 zf-Mss51
Other DBs
NCBI-GeneID: 100939294
NCBI-ProteinID: XP_024087186
LinkDB
Position
14
AA seq 275 aa
MKFGLSWVFLAAIFAGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNTDMNWVREAS
GKGLEWVLGISWNGGRMHYADSVKGRFTISRDNSRKPLYLQKNRRRAEDMAVYYCVRNPV
RGHKCEPRHKPPAGTLGEISCRGRSGPTDQSQPQSRNERSSTMVTSIRVVRKLRGACPGS
FSSKCHSDPVYDKNCVFQRTHVLVKPSETLSFTCAASGFPIITSTSSWGWICQPPGKELK
WVRCVGHEEAHSTTRFSRVQSPPPDPHSESSFSYS
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaaatttgggctaagttgggtttttcttgctgctatttttgcaggtgtgcagtgtgag
gtgcagctggtggagtctgggggagggttggtacagcctggggggtccctgagactctcc
tgtgcagcctctggattcaccttcagtaacactgacatgaactgggtccgcgaggcttca
ggaaaggggctggagtgggtcttgggtattagttggaatggtggtaggatgcactatgcg
gactccgtgaagggccgatttaccatctccagagacaattccaggaagcccctgtatctg
caaaagaacagacggagagccgaggacatggccgtgtattactgtgtgagaaatcctgtg
aggggacacaagtgtgagcccagacacaaacctcctgcaggaacgttgggggaaatcagc
tgcagggggcgctcaggacccactgatcagagtcaaccccagagcaggaatgaaaggtcc
tcaaccatggtcaccagcatcagagtcgtgaggaagctcaggggtgcctgcccaggatcg
ttctcatcaaaatgtcattcagatcctgtgtatgacaaaaattgtgtttttcagcgcact
catgttctagtaaagccctcagagaccctctccttcacctgtgctgcctctggatttccg
atcataaccagtacttcctcctggggctggatctgccagcctccagggaaggagctgaag
tgggtcaggtgtgtaggtcatgaggaagcacacagtacaacccgcttctcaagagtccag
tcaccacctccagatccacattcagaaagcagtttttcctacagctga

DBGET integrated database retrieval system