Pongo abelii (Sumatran orangutan): 100431520 Help Entry 100431520         CDS       T01416                                  Definition (RefSeq) immunoglobulin delta heavy chain-like   KO K06856   immunoglobulin heavy chain Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04020   Calcium signaling pathway pon04064   NF-kappa B signaling pathway pon04072   Phospholipase D signaling pathway pon04145   Phagosome pon04151   PI3K-Akt signaling pathway pon04640   Hematopoietic cell lineage pon04650   Natural killer cell mediated cytotoxicity pon04662   B cell receptor signaling pathway pon04664   Fc epsilon RI signaling pathway pon04666   Fc gamma R-mediated phagocytosis pon04672   Intestinal immune network for IgA production pon05135   Yersinia infection pon05140   Leishmaniasis pon05143   African trypanosomiasis pon05146   Amoebiasis pon05150   Staphylococcus aureus infection pon05152   Tuberculosis pon05169   Epstein-Barr virus infection pon05171   Coronavirus disease - COVID-19 pon05202   Transcriptional misregulation in cancer pon05310   Asthma pon05320   Autoimmune thyroid disease pon05322   Systemic lupus erythematosus pon05323   Rheumatoid arthritis pon05330   Allograft rejection pon05340   Primary immunodeficiency pon05414   Dilated cardiomyopathy pon05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100431520    04020 Calcium signaling pathway     100431520    04072 Phospholipase D signaling pathway     100431520    04151 PI3K-Akt signaling pathway     100431520  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100431520  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100431520    04650 Natural killer cell mediated cytotoxicity     100431520    04662 B cell receptor signaling pathway     100431520    04664 Fc epsilon RI signaling pathway     100431520    04666 Fc gamma R-mediated phagocytosis     100431520    04672 Intestinal immune network for IgA production     100431520  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100431520   09163 Immune disease    05310 Asthma     100431520    05322 Systemic lupus erythematosus     100431520    05323 Rheumatoid arthritis     100431520    05320 Autoimmune thyroid disease     100431520    05330 Allograft rejection     100431520    05340 Primary immunodeficiency     100431520   09166 Cardiovascular disease    05414 Dilated cardiomyopathy     100431520    05416 Viral myocarditis     100431520   09171 Infectious disease: bacterial    05135 Yersinia infection     100431520    05150 Staphylococcus aureus infection     100431520    05152 Tuberculosis     100431520   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100431520    05169 Epstein-Barr virus infection     100431520   09174 Infectious disease: parasitic    05146 Amoebiasis     100431520    05140 Leishmaniasis     100431520    05143 African trypanosomiasis     100431520  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100431520 Membrane trafficking [BR:pon04131]  Endocytosis   Phagocytosis    Opsonins     100431520 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  V-set Ig_3 Motif Other DBs NCBI-GeneID:  100431520 NCBI-ProteinID:  XP_024087189 LinkDB All DBs Position 14 AA seq 243 aa AA seqDB search MDWIWRILFLVAAATGAHSQVQLGQSGPEVKKPESSVKVSCKASGYTFTSSAMQWVRQAP GQGLEWIGWIIVGSGNTNYAQKFQGRVTITRDTSTSTAYMELSSLRSEDTAVYYCAADTD TRVRSEPPGCAHDTRGCSEPPGGGRDTRGCLQQQGTLRTTRWPLGHQGVFGTTRGCSEPT WGVQDTRRHSEPRGSDQDNRGCSGPPGGAQDTKEHSEAPGGTQDTREGGTENHQGVLRTS VSS NT seq 732 nt NT seq  +upstreamnt  +downstreamnt atggactggatttggaggatcctcttcttggtggcagcagcgactggtgcccactcccag gtccagctggggcagtctgggcctgaggtgaagaagcctgagtcctcagtgaaggtctcc tgcaaggcttctggatacacctttactagctctgctatgcagtgggtgcgacaggctcct ggacaaggccttgagtggataggatggatcatcgttggcagtggtaacacaaactatgca cagaagttccagggaagagtcaccattaccagggacacgtccacgagcacagcctacatg gagctgagcagcctgagatccgaggacacggccgtgtattactgtgcggcagacacagac accagggtgcgctcagaaccaccagggtgcgctcatgacaccagggggtgctcagaacca ccggggggtggtcgggacaccagagggtgcttacaacaacaggggacgctcagaaccacc aggtggcccttaggacaccagggggtgttcggaaccaccagggggtgctcagaaccaaca tggggcgttcaggacaccaggagacactcagaaccaagagggagcgatcaggacaacagg ggttgctcaggaccaccagggggagctcaggacaccaaggagcactcagaagcaccaggg ggcactcaggacaccagagaggggggcactgagaaccaccaaggggtgctcaggacatca gtgtcctcttag

Pongo abelii (Sumatran orangutan): 100939054 Help Entry 100939054         CDS       T01416                                  Definition (RefSeq) immunoglobulin alpha-2 heavy chain-like   KO K06856   immunoglobulin heavy chain Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04020   Calcium signaling pathway pon04064   NF-kappa B signaling pathway pon04072   Phospholipase D signaling pathway pon04145   Phagosome pon04151   PI3K-Akt signaling pathway pon04640   Hematopoietic cell lineage pon04650   Natural killer cell mediated cytotoxicity pon04662   B cell receptor signaling pathway pon04664   Fc epsilon RI signaling pathway pon04666   Fc gamma R-mediated phagocytosis pon04672   Intestinal immune network for IgA production pon05135   Yersinia infection pon05140   Leishmaniasis pon05143   African trypanosomiasis pon05146   Amoebiasis pon05150   Staphylococcus aureus infection pon05152   Tuberculosis pon05169   Epstein-Barr virus infection pon05171   Coronavirus disease - COVID-19 pon05202   Transcriptional misregulation in cancer pon05310   Asthma pon05320   Autoimmune thyroid disease pon05322   Systemic lupus erythematosus pon05323   Rheumatoid arthritis pon05330   Allograft rejection pon05340   Primary immunodeficiency pon05414   Dilated cardiomyopathy pon05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100939054    04020 Calcium signaling pathway     100939054    04072 Phospholipase D signaling pathway     100939054    04151 PI3K-Akt signaling pathway     100939054  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100939054  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100939054    04650 Natural killer cell mediated cytotoxicity     100939054    04662 B cell receptor signaling pathway     100939054    04664 Fc epsilon RI signaling pathway     100939054    04666 Fc gamma R-mediated phagocytosis     100939054    04672 Intestinal immune network for IgA production     100939054  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100939054   09163 Immune disease    05310 Asthma     100939054    05322 Systemic lupus erythematosus     100939054    05323 Rheumatoid arthritis     100939054    05320 Autoimmune thyroid disease     100939054    05330 Allograft rejection     100939054    05340 Primary immunodeficiency     100939054   09166 Cardiovascular disease    05414 Dilated cardiomyopathy     100939054    05416 Viral myocarditis     100939054   09171 Infectious disease: bacterial    05135 Yersinia infection     100939054    05150 Staphylococcus aureus infection     100939054    05152 Tuberculosis     100939054   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100939054    05169 Epstein-Barr virus infection     100939054   09174 Infectious disease: parasitic    05146 Amoebiasis     100939054    05140 Leishmaniasis     100939054    05143 African trypanosomiasis     100939054  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100939054 Membrane trafficking [BR:pon04131]  Endocytosis   Phagocytosis    Opsonins     100939054 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  V-set Ig_3 PG_isomerase_N zf-Mss51 Motif Other DBs NCBI-GeneID:  100939054 NCBI-ProteinID:  XP_024087185 LinkDB All DBs Position 14 AA seq 236 aa AA seqDB search MGWTCKILFLVAAATGAHSQVQLVQSGAEMKKPGSSVKVSCKASGYTFTYCYLHWVRQAT GKGLEWVSYISGDSSYTSYADSVKGRFTISRDNAKNSLYLQMNSLRVEDTAVYYCVKHTG GVASATKYLPHEYANALASTEVNTDLSLPREHHTTTASLPSEAPRAQHLTMDCTWRILLL VAAATGAHSQVQPVQSGAEVRKPGSSVKVSCKVSRSTFTFHYMHWVRQAPGKQTIS NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atgggctggacctgcaagatcctcttcttggtggcagcagccacaggtgcccactcccag gtgcagctggtgcaatctggggctgagatgaagaagcctgggtcctcagtgaaggtctcc tgcaaggcttctggatacaccttcacttactgctacttgcactgggtgcgacaggctaca gggaagggactggagtgggtttcatacattagtggtgatagtagttacacaagctacgca gactctgtgaagggccgattcaccatctccagggacaacgccaagaactcactgtatctg caaatgaacagcctgagagtcgaggacacggctgtgtattactgtgtgaaacacacaggt ggggtggcttcagctacgaaatacctgcctcatgaatatgcaaatgcactggcatctacc gaggtaaatacagatctgtccttgcccagagagcatcacacaacaaccgcatccctcccc tcagaagcccccagagcacagcacctcaccatggactgcacctggaggattctcctcttg gtggcagcagctacaggtgcccactcccaggtgcagccggtgcagtctggagctgaggtg aggaaacctgggtcctcagtgaaggtctcctgcaaagtttccagatccaccttcaccttc cactacatgcactgggtgcgacaggcccctggaaaacaaactatctcttga

Pongo abelii (Sumatran orangutan): 100939231 Help Entry 100939231         CDS       T01416                                  Definition (RefSeq) uncharacterized protein LOC100939231   KO K06856   immunoglobulin heavy chain Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04020   Calcium signaling pathway pon04064   NF-kappa B signaling pathway pon04072   Phospholipase D signaling pathway pon04145   Phagosome pon04151   PI3K-Akt signaling pathway pon04640   Hematopoietic cell lineage pon04650   Natural killer cell mediated cytotoxicity pon04662   B cell receptor signaling pathway pon04664   Fc epsilon RI signaling pathway pon04666   Fc gamma R-mediated phagocytosis pon04672   Intestinal immune network for IgA production pon05135   Yersinia infection pon05140   Leishmaniasis pon05143   African trypanosomiasis pon05146   Amoebiasis pon05150   Staphylococcus aureus infection pon05152   Tuberculosis pon05169   Epstein-Barr virus infection pon05171   Coronavirus disease - COVID-19 pon05202   Transcriptional misregulation in cancer pon05310   Asthma pon05320   Autoimmune thyroid disease pon05322   Systemic lupus erythematosus pon05323   Rheumatoid arthritis pon05330   Allograft rejection pon05340   Primary immunodeficiency pon05414   Dilated cardiomyopathy pon05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100939231    04020 Calcium signaling pathway     100939231    04072 Phospholipase D signaling pathway     100939231    04151 PI3K-Akt signaling pathway     100939231  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100939231  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100939231    04650 Natural killer cell mediated cytotoxicity     100939231    04662 B cell receptor signaling pathway     100939231    04664 Fc epsilon RI signaling pathway     100939231    04666 Fc gamma R-mediated phagocytosis     100939231    04672 Intestinal immune network for IgA production     100939231  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100939231   09163 Immune disease    05310 Asthma     100939231    05322 Systemic lupus erythematosus     100939231    05323 Rheumatoid arthritis     100939231    05320 Autoimmune thyroid disease     100939231    05330 Allograft rejection     100939231    05340 Primary immunodeficiency     100939231   09166 Cardiovascular disease    05414 Dilated cardiomyopathy     100939231    05416 Viral myocarditis     100939231   09171 Infectious disease: bacterial    05135 Yersinia infection     100939231    05150 Staphylococcus aureus infection     100939231    05152 Tuberculosis     100939231   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100939231    05169 Epstein-Barr virus infection     100939231   09174 Infectious disease: parasitic    05146 Amoebiasis     100939231    05140 Leishmaniasis     100939231    05143 African trypanosomiasis     100939231  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100939231 Membrane trafficking [BR:pon04131]  Endocytosis   Phagocytosis    Opsonins     100939231 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  V-set Ig_3 ig Motif Other DBs NCBI-GeneID:  100939231 NCBI-ProteinID:  XP_024087190 LinkDB All DBs Position 14 AA seq 245 aa AA seqDB search MELGLSWVFLVAILEGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAP GKGLEWVSYISGDSSYINYADSVKGRFTISRDNAKNSLYLRMNSLRAEDTAVYYCAQVTL KESGPALVKPTQTLTLTCTFSGFSLSTSGVGVGWIRQPPGKALEWLASIDWDDDKYYSPS LKSRLTISKDTSKNQVVITMTNMDPVDTATYYCARIPQRHSPGLLLYKNPGCFSVVLPPH LCRTG NT seq 738 nt NT seq  +upstreamnt  +downstreamnt atggaattggggctgagctgggttttccttgttgccattttagaaggtgtccagtgtgag gtgcagctggtggagtctgggggaggcttggtacagcctgggggttccctgagactctcc tgtgcagcctctggattcacattcagtagctatggcatgaactgggtccgccaggctcca gggaaggggctggagtgggtttcatacattagtggtgacagtagttacataaactacgca gactctgtgaagggccgattcaccatctccagagacaacgccaagaactcattgtatctg cgaatgaacagcctgagagccgaggacacggctgtttattactgtgcccaggtcaccttg aaggagtctggtcctgcgttggtgaaacccacacagaccctcacgctgacctgcaccttc tctgggttctcactcagcactagtggagtgggtgtgggctggatccgtcagcccccaggg aaggccctggagtggcttgcaagcattgattgggatgatgataaatactacagcccatct ctgaagagcaggctcaccatctccaaggacacctccaaaaaccaggtggtcattacaatg accaacatggaccctgtggacacagccacatattactgtgcacggataccacagagacac agcccagggctcctcctgtacaagaacccaggctgcttctcagtggtgctccctccccac ctctgcagaacaggatag

Pongo abelii (Sumatran orangutan): 100939294 Help Entry 100939294         CDS       T01416                                  Definition (RefSeq) uncharacterized protein LOC100939294   KO K06856   immunoglobulin heavy chain Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04020   Calcium signaling pathway pon04064   NF-kappa B signaling pathway pon04072   Phospholipase D signaling pathway pon04145   Phagosome pon04151   PI3K-Akt signaling pathway pon04640   Hematopoietic cell lineage pon04650   Natural killer cell mediated cytotoxicity pon04662   B cell receptor signaling pathway pon04664   Fc epsilon RI signaling pathway pon04666   Fc gamma R-mediated phagocytosis pon04672   Intestinal immune network for IgA production pon05135   Yersinia infection pon05140   Leishmaniasis pon05143   African trypanosomiasis pon05146   Amoebiasis pon05150   Staphylococcus aureus infection pon05152   Tuberculosis pon05169   Epstein-Barr virus infection pon05171   Coronavirus disease - COVID-19 pon05202   Transcriptional misregulation in cancer pon05310   Asthma pon05320   Autoimmune thyroid disease pon05322   Systemic lupus erythematosus pon05323   Rheumatoid arthritis pon05330   Allograft rejection pon05340   Primary immunodeficiency pon05414   Dilated cardiomyopathy pon05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100939294    04020 Calcium signaling pathway     100939294    04072 Phospholipase D signaling pathway     100939294    04151 PI3K-Akt signaling pathway     100939294  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100939294  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100939294    04650 Natural killer cell mediated cytotoxicity     100939294    04662 B cell receptor signaling pathway     100939294    04664 Fc epsilon RI signaling pathway     100939294    04666 Fc gamma R-mediated phagocytosis     100939294    04672 Intestinal immune network for IgA production     100939294  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100939294   09163 Immune disease    05310 Asthma     100939294    05322 Systemic lupus erythematosus     100939294    05323 Rheumatoid arthritis     100939294    05320 Autoimmune thyroid disease     100939294    05330 Allograft rejection     100939294    05340 Primary immunodeficiency     100939294   09166 Cardiovascular disease    05414 Dilated cardiomyopathy     100939294    05416 Viral myocarditis     100939294   09171 Infectious disease: bacterial    05135 Yersinia infection     100939294    05150 Staphylococcus aureus infection     100939294    05152 Tuberculosis     100939294   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100939294    05169 Epstein-Barr virus infection     100939294   09174 Infectious disease: parasitic    05146 Amoebiasis     100939294    05140 Leishmaniasis     100939294    05143 African trypanosomiasis     100939294  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100939294 Membrane trafficking [BR:pon04131]  Endocytosis   Phagocytosis    Opsonins     100939294 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  V-set ig Ig_3 zf-Mss51 Motif Other DBs NCBI-GeneID:  100939294 NCBI-ProteinID:  XP_024087186 LinkDB All DBs Position 14 AA seq 275 aa AA seqDB search MKFGLSWVFLAAIFAGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNTDMNWVREAS GKGLEWVLGISWNGGRMHYADSVKGRFTISRDNSRKPLYLQKNRRRAEDMAVYYCVRNPV RGHKCEPRHKPPAGTLGEISCRGRSGPTDQSQPQSRNERSSTMVTSIRVVRKLRGACPGS FSSKCHSDPVYDKNCVFQRTHVLVKPSETLSFTCAASGFPIITSTSSWGWICQPPGKELK WVRCVGHEEAHSTTRFSRVQSPPPDPHSESSFSYS NT seq 828 nt NT seq  +upstreamnt  +downstreamnt atgaaatttgggctaagttgggtttttcttgctgctatttttgcaggtgtgcagtgtgag gtgcagctggtggagtctgggggagggttggtacagcctggggggtccctgagactctcc tgtgcagcctctggattcaccttcagtaacactgacatgaactgggtccgcgaggcttca ggaaaggggctggagtgggtcttgggtattagttggaatggtggtaggatgcactatgcg gactccgtgaagggccgatttaccatctccagagacaattccaggaagcccctgtatctg caaaagaacagacggagagccgaggacatggccgtgtattactgtgtgagaaatcctgtg aggggacacaagtgtgagcccagacacaaacctcctgcaggaacgttgggggaaatcagc tgcagggggcgctcaggacccactgatcagagtcaaccccagagcaggaatgaaaggtcc tcaaccatggtcaccagcatcagagtcgtgaggaagctcaggggtgcctgcccaggatcg ttctcatcaaaatgtcattcagatcctgtgtatgacaaaaattgtgtttttcagcgcact catgttctagtaaagccctcagagaccctctccttcacctgtgctgcctctggatttccg atcataaccagtacttcctcctggggctggatctgccagcctccagggaaggagctgaag tgggtcaggtgtgtaggtcatgaggaagcacacagtacaacccgcttctcaagagtccag tcaccacctccagatccacattcagaaagcagtttttcctacagctga

DBGET integrated database retrieval system