KEGG   Pongo abelii (Sumatran orangutan): 100431592
Entry
100431592         CDS       T01416                                 

Gene name
GLS
Definition
(RefSeq) glutaminase kidney isoform, mitochondrial isoform X1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00220  Arginine biosynthesis
pon00250  Alanine, aspartate and glutamate metabolism
pon00471  D-Glutamine and D-glutamate metabolism
pon01100  Metabolic pathways
pon04724  Glutamatergic synapse
pon04727  GABAergic synapse
pon04964  Proximal tubule bicarbonate reclamation
pon05206  MicroRNAs in cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100431592 (GLS)
   00220 Arginine biosynthesis
    100431592 (GLS)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100431592 (GLS)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100431592 (GLS)
  09156 Nervous system
   04724 Glutamatergic synapse
    100431592 (GLS)
   04727 GABAergic synapse
    100431592 (GLS)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100431592 (GLS)
   05230 Central carbon metabolism in cancer
    100431592 (GLS)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100431592 (GLS)
SSDB
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_3 Ank_5 Ank
Other DBs
NCBI-GeneID: 100431592
NCBI-ProteinID: XP_002812725
Ensembl: ENSPPYG00000013026
UniProt: H2P854 A0A6D2XW33
LinkDB
Position
2B
AA seq 669 aa
MMRLRGSAMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGG
GGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctgcgggacctgctcctgcggtcgcccgccggc
gtgagcgcgactctgcggcgggcacagcccctggtcaccctgtgccggcgtccccgaggc
gggggacggccggcagcgggcccggctgccgccgcgcgactccacccgtggtggggcggg
ggcggctggccggcggagcccctcgcgcggggcctgtccagctctccttcggagatcttg
caggaactgggcaagggaagcacgcatccgcagcccggggtgtcgccacccgctgccccg
gcggcgcccggccccaaggacggccccggggagacggacgcgtttggcaacagcgagggc
aaagagctggtggcctcaggtgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcggaaggacaagagaaaatacctgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacgtcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcagagcaacattgttttgttgacacaagcatttagaagaaagtttgtc
attcctgactttatgtcttttacctcacacattgatgagttatatgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcaattggccaaattcagtcccgatttg
tggggtgtgtctgtttgtacagtagatggacagaggcattctactggagataccaaagtt
cccttctgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgatctt
ggaactgagtatgtgcatcgatatgttggaaaagagccgagtggactaagattcaacaaa
ctatttttgaatgaagatgataaaccacataatcctatggtaaatgctggagcaattgtt
gtgacttcactaataaagcaaggagtaaataatgctgaaaaatttgactatgtcatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcaacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaagaagtgt
tttccagaaggcacagacatggttggtatattagacttctacttccagctgtgctccatt
gaagtgacttgtgaatcagccagtgtgatggctgcgacactggctaatggtggtttctgc
ccaattactggtgaaagagtactgagccctgaagcagttcgaaatacattgagtttgatg
cattcctgtggcatgtatgacttctcagggcagtttgctttccatgttggtcttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgttatgggtatgatgtgc
tggtctcctcctctggataagatgggcaacagtgttaagggaattcacttttgtcacgat
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaatcttttgtttgct
gcatatactggagatgtgtctgcacttcgaagatttgctttgtcagctatggacatggaa
cagcgggactatgattctagaacagcactccatgtagctgctgcagagggtcatgttgaa
gttgttaaatttttgctggaagcctgcaaagtaaaccctttccccaaggacaggtggaat
aacactcccatggatgaagcactgcactttggacaccatgatgtatttaaaattctccaa
gaataccaagtccagtacacacctcaaggagattctgacaacgggaaggaaaatcaaacc
gtccataagaatcttgatggattgttgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100453856
Entry
100453856         CDS       T01416                                 

Gene name
GLS2
Definition
(RefSeq) glutaminase liver isoform, mitochondrial isoform X2
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00220  Arginine biosynthesis
pon00250  Alanine, aspartate and glutamate metabolism
pon00471  D-Glutamine and D-glutamate metabolism
pon01100  Metabolic pathways
pon04724  Glutamatergic synapse
pon04727  GABAergic synapse
pon04964  Proximal tubule bicarbonate reclamation
pon05206  MicroRNAs in cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100453856 (GLS2)
   00220 Arginine biosynthesis
    100453856 (GLS2)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100453856 (GLS2)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100453856 (GLS2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100453856 (GLS2)
   04727 GABAergic synapse
    100453856 (GLS2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100453856 (GLS2)
   05230 Central carbon metabolism in cancer
    100453856 (GLS2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100453856 (GLS2)
SSDB
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 100453856
NCBI-ProteinID: XP_002823447
Ensembl: ENSPPYG00000004664
UniProt: A0A663DDS0 H2NHQ6
LinkDB
Position
12
AA seq 602 aa
MRSMKALQKALSRAGSHCGRGGWGHLSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQ
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKELTGGKVT
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGA
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLES
MV
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgcgctccatgaaggctctgcagaaggccctgagccgggccggcagtcactgcgggcga
ggaggctggggtcacctgagccggagccccctccttggcgggggcgtccggcaccacctc
agtgaggccgcggcgcagggcagagagacgccacacagccaccagccgcagcaccaggat
catgattcatcagaaagtggcatgctgtcccgcctgggtgatttgctcttttacactatt
gctgaaggacaggaacgaatccctatccacaagttcaccactgcactaaaggccactgga
ctgcagacatcagatcctcggctccgagactgcatgagcgagatgcaccgcgtggtccaa
gagtccagtagtggtggcctcttggaccgagatctcttccgaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgggccatgtggatcgcatctttgaggatgccaaagagctcactggaggcaaagtgaca
gcctacatccctcagctggccaagtcaaacccagacctgtggggtgtctccctgtgcact
gtggatggtcagcggcactctgtgggccacacaaagatccccttctgcctgcagtcctgt
gtgaagcccctcacctatgccatctccataagcaccctaggcactgactacgtgcacaag
tttgtgggcaaagagccaagtggcctgcgctacaacaagctctccctcaatgaggaagga
atcccccataaccccatggtcaatgctggtgccattgttgtcagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtgttgcagtatctcaacaaaatggctggg
aatgaatacatgggtttcagcaatgccacattccagtcagagaaggaaacaggggatcgg
aattatgccatcggctattatctcaaggaaaagaagtgctttcctaagggggtggacatg
atggctgcccttgatctctacttccagctgtgctctgtggaggtcacttgtgaatcaggc
agtgtcatggcagccaccctcgccaatggtgggatctgccccatcacaggcgagagtgtg
ctgagtgctgaagcagtgcgcaacaccctcagcctcatgcattcctgcggcatgtatgac
ttctctggccagtttgccttccacgtgggcctgccagccaagtcagctgtatcaggagcc
atcctcctggtggtacccaatgtcatgggaatgatgtgcctgtcacccccattggacaag
ctggggaacagccacagggggaccagcttctgccagaagttggtgtctctcttcaatttc
cacaactatgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggca
gaagttcggaacaagactgtggtcaacctgttatttgctgcctatagtggcgatgtctca
gctcttcgaaggtttgccttgtcagccatggatatggaacagaaagactatgactcgcgc
acagctctgcatgttgctgcagctgaaggacacatcgaagttgttaaattcctgatcgag
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacattcccctggatgatgct
gtgcagttcaaccatctggaggtggtcaaactgcttcaagattaccaggactcctacaca
ctctctgagactcaggctgaggcagcagctgaggccctgtccaaagagaacttagaaagc
atggtatga

DBGET integrated database retrieval system