KEGG   Pongo abelii (Sumatran orangutan): 100431600
Entry
100431600         CDS       T01416                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X2
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04380  Osteoclast differentiation
pon04530  Tight junction
pon04620  Toll-like receptor signaling pathway
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04912  GnRH signaling pathway
pon04926  Relaxin signaling pathway
pon05010  Alzheimer disease
pon05016  Huntington disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05161  Hepatitis B
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100431600 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431600 (MAP2K7)
   04012 ErbB signaling pathway
    100431600 (MAP2K7)
   04668 TNF signaling pathway
    100431600 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100431600 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100431600 (MAP2K7)
   04660 T cell receptor signaling pathway
    100431600 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    100431600 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100431600 (MAP2K7)
   04926 Relaxin signaling pathway
    100431600 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100431600 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100431600 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100431600 (MAP2K7)
   05016 Huntington disease
    100431600 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    100431600 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100431600 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100431600 (MAP2K7)
   05135 Yersinia infection
    100431600 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100431600 (MAP2K7)
   05161 Hepatitis B
    100431600 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100431600 (MAP2K7)
   05169 Epstein-Barr virus infection
    100431600 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100431600 (MAP2K7)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100431600 (MAP2K7)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE7 family
   100431600 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100431600
NCBI-ProteinID: XP_002828615
Ensembl: ENSPPYG00000009493
UniProt: A0A2J8RD71
LinkDB
Position
19
AA seq 419 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccgctggccaacgatgggggcagccgctcgccatcctcagagagc
tccccgcagcaccccacgccccctgcccggccccgccacatgctggggctcccgtcaacc
ctgttcacaccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaacgacctg
gagaacttgggcgagatgggcagcggcacctgcggccaggtgtggaagatgcgcttccgg
aagaccggccacgtcattgctgttaagcaaatgcggcgctcggggaacaaggaggagaac
aagcgcatcctcatggacctggacgtggtgctcaagagccacgactgcccctacatcgtg
cagtgctttgggacgttcatcaccaacacggatgtcttcatcgccatggagctcatgggt
acctgcgctgaaaagctgaagaagcggatgcagggccccatccccgagcgcatcctgggc
aagatgacagtggcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatc
caccgcgacgtcaagccctccaacatcctgctggacgagcggggccagatcaagctctgt
gacttcggcatcagcggccgcctggtggactccaaagccaagacgcggagcgctggctgc
gccgcctacatggcacccgagcgcattgaccccccagaccccaccaagccggactatgac
atccgggccgacgtatggagcctgggcatctcgttggtggagctggcaacgggacagttt
ccctacaagaactgcaagacggactttgaggtcctcaccaaagtcctacaggaagagccc
ccgcttctgcccggacacatgggcttctcaggggacttccagtccttcgtcaaagactgc
cttactaaagatcacaggaagagaccaaagtataataagctacttgaacacagtttcatc
aagcgctacgagacgctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaag
actgagtcaccgcggactagcggcgtcctgagccagccccacctgcccttcttcaggtag

KEGG   Pongo abelii (Sumatran orangutan): 100439299
Entry
100439299         CDS       T01416                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04620  Toll-like receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04912  GnRH signaling pathway
pon04926  Relaxin signaling pathway
pon04935  Growth hormone synthesis, secretion and action
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05142  Chagas disease
pon05161  Hepatitis B
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100439299 (MAP2K4)
   04012 ErbB signaling pathway
    100439299 (MAP2K4)
   04668 TNF signaling pathway
    100439299 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100439299 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100439299 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100439299 (MAP2K4)
   04926 Relaxin signaling pathway
    100439299 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    100439299 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100439299 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100439299 (MAP2K4)
   05135 Yersinia infection
    100439299 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100439299 (MAP2K4)
   05161 Hepatitis B
    100439299 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100439299 (MAP2K4)
   05169 Epstein-Barr virus infection
    100439299 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100439299 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100439299 (MAP2K4)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100439299 (MAP2K4)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE7 family
   100439299 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100439299
NCBI-ProteinID: XP_002827100
LinkDB
Position
17
AA seq 399 aa
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
ccgggccccgtagggtccccggcgccgggccacccggccgtcagcagcatgcagggtaaa
cgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggtttact
ctgaatcccaatcctacaggagttcaaaacccacacatagagagactgagaacacacagc
attgagtcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagag
gacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtc
cacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaaaaa
gaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgcccatac
attgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaactc
atgtctacctcgtttgacaagttttacaaatatgtatatagtgtattagatgatgttatt
ccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaa
gaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctggacagaagt
ggaaatattaagctctgtgacttcggcatcagtggacagcttgtggactctattgccaag
acaagagatgctggctgtaggccatacatggcacctgaaagaatagacccaagcgcatca
cgacaaggatatgatgtccgctctgatgtctggagtttggggatcacattgtatgagttg
gccacgggccgatttccttatccaaagtggaatagtgtatttgatcaactaacacaagtc
gtgaaaggagatcctccgcagctgagtaattctgaggaaagggaattctccccgagtttc
atcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagag
cttctgaaacatccctttattttgatgtatgaagaacgtgccgttgaggtcgcatgctat
gtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system