KEGG   Pongo abelii (Sumatran orangutan): 100431606
Entry
100431606         CDS       T01416                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00310  Lysine degradation
pon01100  Metabolic pathways
pon04010  MAPK signaling pathway
pon05200  Pathways in cancer
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100431606 (MECOM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431606 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431606 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100431606 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100431606 (MECOM)
   03036 Chromosome and associated proteins [BR:pon03036]
    100431606 (MECOM)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     100431606 (MECOM)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    100431606 (MECOM)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100431606 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_11 zf-C2H2_8 PyrI_C
Other DBs
NCBI-GeneID: 100431606
NCBI-ProteinID: XP_024100839
Ensembl: ENSPPYG00000014277
LinkDB
Position
3
AA seq 1052 aa
MKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQ
KLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGF
SFSFPGLFPSGLYHRPPLIPASSPVKGLPSTEQTNKSQSPLMTHPQILPATQDILKALSK
HPSVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIES
DKEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSP
GEVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTTATSQDQPLDLSMGSRSRASGTK
LTEPRKNHVFGEKKGSNIESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKY
LRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPN
ALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
VRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDK
EDAYFTEIRNFIVNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLL
DEEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSAL
DHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKE
SLHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgaagagcgaagactatccccatgaaactatggcgccggatatccacgaagaacggcaa
tatcgctgtgaagactgtgaccagctctttgaatctaaggctgaactagcagatcaccaa
aagtttccatgcagtactcctcattcagcattttcaatggttgaagaggattttcagcaa
aaactcgaaagcgagaatgatctccaagagatacacacgatccaggagtgtaaggaatgt
gaccaagtttttcctgatttgcaaagcctggagaaacacatgctgtcacatactgaagag
agggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgccaagcaggtt
ttcacggaccctagcaaccttcagcggcacattcgctctcagcatgtcggtgcccgggcc
catgcatgcccggagtgtggcaaaacgtttgccacttcgtcgggcctcaaacaacacaag
cacatccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcag
ttttcaaacctttgccgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgt
gagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgct
gactattttggcgccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttgatacct
gctagttctcctgttaaaggactaccaagtactgaacagacaaacaaaagtcaaagtccc
ctcatgacacatcctcagatactgccagctacacaggatattttgaaggcactatctaaa
cacccatctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagag
aggccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtaca
ccaagtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacattgaaagt
gataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcag
aatctggcttcaataaataataagaaagaatacagcaatcattccattttctcaccatct
ttagaggagcagactgcggtgtcaggagctgtgaatgattctataaaggctattgcttct
attgctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatg
tacccatttcctgatagagacttgagatcgttacctttgaaaatggaaccccaatcacca
ggtgaagtaaagaaactgcagaagggcagctctgagtccccctttgatctcaccactaag
cgaaaggatgagaagcccttgactccagtcccctccaagcctccagtgacgactgccaca
agccaagaccagcccctggatctaagtatgggcagtaggagtagagccagtgggacaaag
ctgactgagcctcgaaaaaaccacgtgtttggggaaaaaaaaggaagcaacatcgaatca
agacctgcttcagatggttccttgcagcatgcaagacccactcctttctttatggaccct
atttacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagagaaatac
ttgaggccttctccaggattcttgtttcacccacaattccaactgcctgatcagagaact
tggatgtcagctattgaaaacatggcagaaaagctagagagcttcagtgccctgaaacct
gaggccagtgagctcttacagtcagtgccctctatgttcaacttcagggcgcctcccaat
gccctgccagagaaccttctgcggaagggaaaggagcgctatacctgcagatactgtggc
aagatttttccaaggtctgcaaacctaacacggcacttgagaacccacacaggagagcag
ccttacagatgcaaatactgtgacagatcatttagcatatcttctaacttgcaaaggcat
gttcgcaacatccacaataaagagaagccatttaagtgtcacttatgtgataggtgtttt
ggtcaacaaaccaatttagacagacacctaaagaaacatgagaatgggaacatgtccggt
acagcaacatcgtcgcctcattctgaactggaaagtacaggtgcgattctggatgacaaa
gaagatgcttacttcacagaaattcgaaatttcattgtgaacagcaaccacggcagccaa
tctcccaggaatgtggaggagagaatgaatggcagtcattttaaagatgaaaaggctttg
gtgaccagtcaaaattcagacttgctggatgatgaagaagttgaagatgaggtgttgtta
gatgaggaggatgaagacaatgatattactggaaaaacaggaaaggaaccagtgacaagt
aatttacatgaaggaaaccctgaggatgactatgaagaaaccagtgccctggagatgagt
tgcaagacatccccagtgaggtataaagaggaagaatataaaagtggactttctgcttta
gatcatataagacacttcacagatagcctcaaaatgaggaaaatggaagataatcaatat
tctgaagctgagctgtcttcttttagtacttcccatgtgccagaggaacttaaacagcca
ttacacagaaagtccaaatcgcaggcgtatgctatgatgctgtcactgtctgacaaggag
tccctccattctacatcccacagttcttccaatgtgtggcacagtatggccagggctgca
gcagaatccagtgctatccagtccataagccacgtatga

DBGET integrated database retrieval system