KEGG   Pongo abelii (Sumatran orangutan): 100431669
Entry
100431669         CDS       T01416                                 

Gene name
PARD3
Definition
(RefSeq) partitioning defective 3 homolog isoform X3
  KO
K04237  partitioning defective protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04144  Endocytosis
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04530  Tight junction
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100431669 (PARD3)
   04390 Hippo signaling pathway
    100431669 (PARD3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100431669 (PARD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100431669 (PARD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100431669 (PARD3)
   04530 Tight junction
    100431669 (PARD3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100431669 (PARD3)
  09158 Development and regeneration
   04360 Axon guidance
    100431669 (PARD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100431669 (PARD3)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100431669 (PARD3)
SSDB
Motif
Pfam: Par3_HAL_N_term PDZ PDZ_6 PDZ_2 TPR_11
Other DBs
NCBI-GeneID: 100431669
NCBI-ProteinID: XP_009243532
Ensembl: ENSPPYG00000002197
LinkDB
Position
10
AA seq 1353 aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDNNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDE
DGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEHENLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRVPRLNHPPEQIDSHSR
LPHSAHPSGKPPSAPASASQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAME
TLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPVETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHD
DVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLD
FVKTRKSKSMDLGIADETKLSTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLN
GDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGRESV
STASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDM
FRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEI
QDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPWNSKPSPVDS
NRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVEVQM
QRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYSSYQ
GSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPSYAP
SKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS
NT seq 4062 nt   +upstreamnt  +downstreamnt
atgaaagtgaccgtgtgcttcggacggacccgggtggtcgtgccgtgcggggacggccac
atgaaagttttcagcctcatccagcaggcggtgacccgctaccggaaggccatcgccaag
gatccaaactactggatacaggtgcatcgcttggaacatggagatggaggaatactagac
cttgatgacattctttgtgatgtagcagacgataaagacagactggtagcagtgtttgat
gagcaggatccacatcacggaggtgatggcaccagtgccagttccacgggtacccagagc
ccagagatatttggtagtgagcttggcaccaacaatgtctcagcctttcagccttaccaa
gcaacaagtgaaattgaggtcacaccttcagtccttcgagcaaatatgcctcttcatgtt
cgacgcagtagtgacccagctctaattggcctctccacttctgtcagtgataataatttt
tcctctgaagagccttcaaggaaaaatcccacacgctggtcaacaacagctggcttcctc
aagcagaacactgctgggagtcctaaaacctgcgacaggaagaaagatgaaaactacaga
agcctcccacgggatactagtaactggtctaaccaatttcagagagacaatgctcgctcg
tctctgagtgccagtcacccaatggtgggcaagtggctggagaaacaagaacaggatgag
gatgggacagaagaggataacagtcgtgttgaacctgttggacatgctgacacgggtttg
gagcatatacccaacttttctctggatgatatggtaaagctcgtagaagtccccaacgat
ggagggcctctgggaatccatgtagtgcctttcagtgctcgaggcggcagaaccctgggg
ttattagtaaaacgattggagaaaggtggtaaagctgaacatgaaaatctttttcatgag
aatgattgcattgtcaggattaatgatggcgaccttcgaaatagaagatttgaacaagca
caacatatgtttcgccaagccatgcgtacacccatcatttggttccatgtggttcctgca
gcaaataaagagcagtatgaacaactatcccaaagtgagaagaacaattactattcaagc
cgttttagccctgacagccagtatattgacaacaggagtgtgaacagtgcagggcttcac
acggtgcagagagtaccccgactgaaccacccgcctgagcagatagactctcactcacga
ctacctcatagcgcacacccctcgggaaaaccaccatccgctccggcctcggcatctcag
aatgtatttagtacgactgtaagcagtggttataacaccaaaaaaataggcaagaggctt
aatatccagcttaagaaaggtacagaaggtttgggattcagcatcacttccagagatgta
acaataggcggctcagctccaatctatgtgaaaaacattctcccccggggggcagctatt
caggatggccgacttaaggcaggggacagacttatagaggtaaatggagtagatttagtg
ggcaaatcccaagaggaagttgtttccctgttgagaagcaccaagatggaaggaactgtg
agccttctggtctttcgccaggaagacgccttccacccaagggaactgaatgcagagcca
agccagatgcagattccaaaagaaacgaaagcagaagatgaggatattgttctcacacct
gatggcaccagggaatttctgacgtttgaagtcccacttaatgattcaggatctgccggc
cttggtgtcagtgtgaaaggtaaccggtcaaaagagaaccacgcagatttgggaatcttt
gtcaagtccattattaatggaggagcagcatctaaagatggaaggcttcgggtgaatgat
caactgatagcagtaaatggagaatccctgttgggcaagacaaaccaagatgccatggaa
accctaagaaggtctatgtctactgaaggcaataaacgaggaatgatccagcttattgtt
gcaaggagaataagcaagtgcaatgagctgaagtcacctgggagcccccctggacctgag
ctgcctgttgaaacagcgctggatgatagagaacgaagaatttcccattccctctacagt
gggattgaggggcttgatgaatcgcccagcagaaatgctgccctcagtaggataatgggt
aaataccagctgtcccctacagtgaatatgccccaagatgacactgtcattatagaagat
gacaggttgccagtgcttcctccacatctctctgaccagtcctcttccagctcccatgat
gatgtggggttcgtgacggcagatgctggtacttgggccaaggctgcaatcagtgattca
gccgactgctctttgagtccagatgttgatccagttcttgcttttcaacgagaaggattt
ggacgtcagagtatgtcagaaaaacgcacaaagcaattttcagatgccagtcaattggat
ttcgttaaaacacgaaaatcaaaaagcatggatttaggtatagctgacgagactaaactc
agtacagtggatgaccagaaagcaggttctcccagcagagatgtgggtccttccctgggt
ctgaagaagtcaagctcattagagagtctgcagaccgcagttgccgaggtgactttgaat
ggggatattcctttccatcgtccacggccgcggataatcagaggcaggggatgcaatgag
agcttcagagctgccatcgacaaatcttatgataaacctgcggtagatgatgatgatgaa
ggcatggagaccttggaagaagacacagaagaaagttcaagatcagggagagagtctgta
tccacagccagtgatcagccttcccactctctggagagacaaatgaatggaaaccaagag
aaaggtgataagactgatagaaaaaaggataaaactggaaaagaaaagaagaaagataga
gataaggagaaggataaaatgaaagccaagaagggaatgctgaagggcttgggagacatg
ttcaggtttggcaaacatcgaaaagatgacaagattgagaaaacgggtaaaataaaaata
caggaatcctttacatcagaagaggagaggatacgaatgaagcaggagcaggagaggatt
caagccaaaactcgagaatttagggaacgacaagctcgagagcgtgactatgctgaaatt
caagattttcatcggacatttggctgtgatgatgagttgatgtatgggggagtttcttct
tatgaaggttccatggctctcaacgctagacctcagagcccacgagaagggcatatgatg
gatgctttgtatgcccaagtcaagaagccgtggaattccaaaccctcacctgtagacagt
aacagatcaactcctagcaaccatgatcggatacagcgtctgaggcaagaatttcagcaa
gcaaagcaggatgaagatgtagaagatcgtcgacggacctatagctttgagcaaccctgg
ccgaacgcacggccggcgacgcagagcgggcggcactcggtgtccgtggaggtgcagatg
cagcggcagcggcaggaggagcgcgagagctcccagcaggcccagcgccagtacagctct
ctgcctcggcaaagcaggaaaaatgccagctcggtctcccaggactcttgggagcagaac
tactcccccggggaaggcttccagagtgccaaagagaaccccaggtactccagctaccaa
ggctccaggaacggctacctgggaggacacggcttcaatgccagggtcatgctggaaact
caggagctccttcgccaggaacagaggcggaaggagcagcagatgaagaagcagcctcct
tccgaggggcccagcaactatgactcgtataagaaagtccaggaccccagttacgcccct
tccaaggggcccttccggcaagacgtgcccccctccccttctcaggttgcgaggctgaac
agacttcagactcctgagaaagggaggcccttctattcctga

DBGET integrated database retrieval system