KEGG   Pongo abelii (Sumatran orangutan): 100431721
Entry
100431721         CDS       T01416                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100431721 (AXIN2)
   04390 Hippo signaling pathway
    100431721 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100431721 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431721 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100431721 (AXIN2)
   05225 Hepatocellular carcinoma
    100431721 (AXIN2)
   05226 Gastric cancer
    100431721 (AXIN2)
   05217 Basal cell carcinoma
    100431721 (AXIN2)
   05213 Endometrial cancer
    100431721 (AXIN2)
   05224 Breast cancer
    100431721 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100431721 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100431721 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100431721 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100431721 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100431721 (AXIN2)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100431721 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind DUF4827
Other DBs
NCBI-GeneID: 100431721
NCBI-ProteinID: XP_024090705
Ensembl: ENSPPYG00000008554
LinkDB
Position
17
AA seq 843 aa
MSSAMLVTRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGSEYYCYSKCKSHPKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQAGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgagtagcgctatgttggtgactcgcctcccagaccccagcagcagcttccgtgaggat
gccccgcggcccccagtgccaggggaagaaggggagaccccaccgtgtcagccaggggtg
ggcaagggccaggtcaccaaacccatgcctgtctcttccaacaccaggcggaacgaagat
gggttgggggagccggaggggcgggcatctccggattcccctctgacccggtggaccaag
tccttacactccttgttgggcgatcaagacggtgcttacctgttcagaactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcattgtctccaagcagctgaagcctgccaccaagacctacataagagatggc
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagaccgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaatgggggacttgggagcctaaaggtc
gtgtgtggctatctccccaccttgaacgaagaagaggagtggacttgtgccgacttcaag
tgcaaactttcgccaaccgtggttggcttgtccagcaaaactctgagggcgacggcgagt
gtgaggtccacggaaactgttgacagtggatacaggtccttcaagaggagcgatcctgtt
aatccttatcacgtaggttctggctatgtctttgcgccagccaccagcgccaacgacagt
gagatatccagcgatgcgctgacggatgattccatgtccatgacggacagcagtgtggat
ggaattcctccttatcgtgtgggcagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaaccggccacctttgcagctgagctgatctcgaggctggagaag
ctgaagctggagttggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagaaggagggctccgagctcacactcaattcgcgggagggggcgcccacgcag
caccccctctccctactgccctccggcagctacgaggaagacccgcagacgatactggac
gatcacctgtccagggtcctcaagacccctggctgccagtctccgggcgtaggccgctat
agcccccgctcccgctccccggaccaccaccaccaccaccattcgcagtaccactccctg
ctcccgcccggtggcaagctgcctcccgcggccgcctcgccgggcgcctgccccctcctc
gggggcaagggctttgtgaccaagcagacgacgaagcatgtccaccaccactacatccac
caccatgccgtccccaagaccaaggaggagatcgaggcggaggccacgcagcgggtgcac
tgcttctgccctgggggcagcgagtattactgctactcgaaatgcaaaagccaccccaag
gctccggaaaccatgcccagcgagcagtttggcggcagcagaggcagtaccttgcccaaa
cgcaatgggaaaggcacggagccgggcctggccctgcccgccagggaaggaggggccccc
ggcggagctggggccctgcagcttccccgggaggaaggagacaggtcgcaggatgtctgg
cagtggatgctggagagtgagcggcagagcaagcccaagccccatagtgcccaaagcaca
aaaaaggcctaccccttggagtctgcccgctcgtctccaggcgaacgagccagccggcac
catctgtgggggggcaacagcgggcacccccgcaccaccccccgtgcccacctgttcacc
caggaccctgcgatgcctcccctgaccccacccaacactctggctcagctggaggaggcc
tgtcgcaggctagctgaggtgtcgaagcccccaaagcagcggtgctgtgtggccagtcag
cagagggacaggaatcactcggccactgttcaggcgggagccacgcccttctccaatcca
agcctggctccagaagatcacaaagagccaaagaaactggcaggtgtccacgcgctccag
gcgagtgagttggttgtcacttactttttctgtggggaagaaattccataccggaggatg
ctgaaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcaagcgatgagtttgcctgtggagcggtgtttgaggaa
atctgggaggatgagacagtgctcccgatgtatgaaggccggattctgggcaaagtggag
cggatcgattga

KEGG   Pongo abelii (Sumatran orangutan): 100434225
Entry
100434225         CDS       T01416                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100434225 (AXIN1)
   04390 Hippo signaling pathway
    100434225 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100434225 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100434225 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100434225 (AXIN1)
   05225 Hepatocellular carcinoma
    100434225 (AXIN1)
   05226 Gastric cancer
    100434225 (AXIN1)
   05217 Basal cell carcinoma
    100434225 (AXIN1)
   05213 Endometrial cancer
    100434225 (AXIN1)
   05224 Breast cancer
    100434225 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100434225 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100434225 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100434225 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100434225 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100434225 (AXIN1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100434225 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 100434225
NCBI-ProteinID: XP_024089076
LinkDB
Position
16
AA seq 867 aa
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGVKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLPDSSVDGIPPYRIRKQRRREMQESV
QVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDVGCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHAPKSGVKLDAAGLHHHRHVHHHVH
HSTGRPKEQVEAEATRRAQSSFAWGPEPHSHGAKSRGYSESVGAAPNASDGLAHSGKAGV
ACKRNAKKAESGKSASTEVPGASEDVEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQ
PHENSRPLSLERPGAVHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLE
EEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLRVVPAVSDMELSETETRSQRKVSGG
SAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGV
VFEEVREDEAILPVFEEKIIGKVEKVD
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccccttggacctcggagcaagtttcaccgaagatgct
ccccgacccccagtgcctggtgaggagggagaactggtgtccacagacccgaggcccgcc
agctatagtttctgctccgggaaaggtgttggcgttaaaggtgagacttcgacggccact
ccgaggcgctcggatctggacctggggtacgagcctgagggcagtgcctcccccacccca
ccatacttgaagtgggctgagtcactgcactccctgctggatgaccaagatgggataagc
ctgttcaggactttcctgaagcaggagggctgtgccgacttgctggacttctggtttgcc
tgcactggcttcaggaagctggagccctgtgactcgaacgaggagaagaggctgaagctg
gcgagagccatctaccgaaagtacattcttgataacaatggcatcgtgtcccggcagacc
aagccagccaccaagagcttcataaagggctgcatcatgaagcagctgatcgatcctgcc
atgtttgaccaggcccagacagaaatccaggccactatggaggaaaacacctatccctcc
ttccttaagtctgatatttatttggaatatacgaggacaggctcggagagcccgaaagtc
tgtagtgaccagagctctgggtcagggacagggaagggcatatctggatacctgccgact
ttaaatgaagatgaggaatggaagtgtgaccaggacatggacgaggacgatggcagagac
gctgctcctcccggaagactccctcagaagctgctcctggagacagctgccccgagggtc
tcctccagtagacggtacagcgaaggcagagagttcaggtatggatcctggcgggagcca
gtcaacccctattatgtcaatgccgggtatgccctggccccagccaccagcgccaacgac
agcgagcaacagagcctgtccagcgatgcagacaccctgtccctcccggacagcagcgtg
gatgggatccccccatacaggatccgtaaacagcgccgcagggagatgcaggagagcgtg
caggtcaacgggcgggtgcccctgcctcacattcctcgcacgtaccgggtgccaaaggag
gtccgcgtggagcctcagaagttcgcggaggagctcatccaccgcctggaggctgtgcag
cgcacgcgggaggccgaggagaagctagaggagcggttgaagcgcgtgcgcatggaggag
gaaggtgaggacggcgatccatcctcagggcccccggggccgtgtcacaagctgcctccc
gcccccgcttggcaccacttcccgccccgctgtgtggacgtgggctgtgctgggctccgg
gatgcacacgaggagaaccctgagagcatcctggacgagcacgtgcagcgtgtgctgagg
acacctggccgccagtcacctgggcctggccaccgctccccggacagtgggcacgtggcc
aagatgccagtggcactggggggtgccgcctcggggcacgggaagcacgcacccaagtca
ggggtgaagctggacgcggccggcctgcaccaccaccgacacgtccaccaccacgtccac
cacagcacaggccggcccaaggagcaggtggaggccgaggccacccgcagggcccagagc
agcttcgcctggggcccggaaccacacagccatggggcaaagtcccgaggctactcagag
agtgtgggcgctgcccccaacgccagtgatggcctggcccacagtgggaaggcgggcgtg
gcatgcaaaagaaatgccaagaaggctgagtcggggaagagcgctagcaccgaggtgcca
ggcgcctcggaagacgtggagaagaaccagaaaatcatgcagtggatcattgagggggag
aaagagatcagcaggcaccgcaggaccggccacgggtcttcagggacgaggaagccacag
ccccatgagaactccagacccttgtcccttgagcgccccggggccgtgcacccctgggcc
ggccctcagctccggacctccgtgcagccctcccacctcttcatccaagaccccacgatg
ccaccccacccagctcccaaccccctaacccagctggaggaggcgcgccgacgtctagag
gaagaagaaaagagagccagccgggcaccctccaagcagaggtatgtgcaggaggttatg
cggcggggacgcgcctgcgtcaggccagcgtgcgcgccagtgctgcgcgtggtaccagcc
gtgtcggacatggagctctccgagacagagacaagatcacagcggaaggtgagcggcggg
agtgcccagccgtgtgacagcatcgttgtagcgtactacttctgcggggaacccatcccc
taccgcaccctggtgaggggccgcgctgtcaccctgggccagttcaaggagctgctgacc
aaaaagggaagctacagatactacttcaagaaagtgagcgacgagtttgactgtggggtg
gtgtttgaggaggttcgagaggacgaggccatcctgcccgtctttgaggagaagatcatc
ggcaaagtggagaaggtggactga

DBGET integrated database retrieval system