KEGG   Pongo abelii (Sumatran orangutan): 100431822
Entry
100431822         CDS       T01416                                 

Gene name
ABCC1
Definition
(RefSeq) multidrug resistance-associated protein 1
  KO
K05665  ATP-binding cassette, subfamily C (CFTR/MRP), member 1 [EC:7.6.2.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01523  Antifolate resistance
pon02010  ABC transporters
pon04071  Sphingolipid signaling pathway
pon04977  Vitamin digestion and absorption
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100431822 (ABCC1)
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100431822 (ABCC1)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    100431822 (ABCC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100431822 (ABCC1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100431822 (ABCC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100431822 (ABCC1)
Enzymes [BR:pon01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.3  ABC-type glutathione-S-conjugate transporter
     100431822 (ABCC1)
Transporters [BR:pon02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    100431822 (ABCC1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase MMR_HSR1 AAA_24
Other DBs
NCBI-GeneID: 100431822
NCBI-ProteinID: XP_024097226
LinkDB
Position
16
AA seq 703 aa
MSYLPQVDIIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDPEENGVTGISG
PGKEAKQMENGMLVMDSAGKQLQRQLSSSSSYSGDISRQHNSTAELQKAGAKKEETWKLM
EADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGT
QEHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASHYLHVDLLHSILRSPMSFFERTP
SGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFF
VQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKA
YYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLV
RMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDF
VLKHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAKGEIIIDGINIAKIGLHDLRF
KITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGE
NLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRL
NTIMDYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgagctacttgccgcaggtggacatcatcattgtcatgagtggcggcaagatctctgag
atgggctcctaccaggagctgctggcccgagacggcgccttcgctgagttcctgcgtacc
tatgccagcacagagcaggagcaggacccagaggagaacggggtcacgggcatcagcggt
ccagggaaggaagcaaagcaaatggagaatggcatgctggtgatggacagtgcagggaag
caactgcagagacagctcagcagctcctcctcctatagcggggacatcagcaggcagcac
aacagcaccgcagaactgcagaaagctggggccaagaaggaggagacctggaagctgatg
gaggctgacaaggcgcagacagggcaggtcaagctttccgtgtactgggactacatgaag
gccatcggactcttcatctcctttctcagcatcttccttttcatgtgtaaccatgtgtct
gcgctggcttccaactattggctcagcctctggactgatgaccccatcgtcaacgggacc
caggagcacacgaaagtccggctgagcgtctatggagccctgggcatttcacaagggatc
gccgtgtttggctactccatggccgtgtccatcggggggatcttggcttcccactatctg
catgtggatctgctgcacagcatcctgcgatcacccatgagcttctttgagcggaccccc
agtgggaacctggtgaaccgcttctccaaggagctggacacagtggactccatgatcccg
gaggtcatcaagatgttcatgggctccctgttcaacgtcatcggtgcctgcattgttatc
ctgctggccacgcccatcgccgcaatcatcatcccgcccctcggcctcatctacttcttc
gtccagaggttctacgtggcctcctctcggcagctgaagcgcctcgagtcggtcagccgc
tccccggtctattcccatttcaacgagaccttgctgggggtcagcgtcattcgagccttc
gaggagcaggagcgcttcatccaccagagtgacctgaaggtggacgagaaccagaaggcc
tattaccccagcatcgtggccaacaggtggctggccgtgcggctggagtgtgtgggcaac
tgcatcgttctgtttgctgccctgttcgcggtgatctccaggcacagcctcagtgctggc
ttggtgggcctctcagtgtcttactcattgcaggtcaccacatacttgaactggctggtt
cggatgtcatctgaaatggaaaccaacattgtggctgtggagagactcaaggagtattca
gagactgagaaggaggcgccctggcaaatccaggagacagctccacccagcagctggccc
caggtgggccgagtggaattccggaactactgcctgcgctaccgagaggacctggacttt
gttctcaagcacatcaatgtcaccatcaatgggggagaaaaggtcggcatcgtggggcgg
acgggagctgggaagtcgtccctgaccctgggcttatttcggatcaacgagtctgccaaa
ggagagatcatcatcgatggcatcaacatcgccaagatcggcctgcacgacctccgcttc
aagatcaccatcatcccccaggaccctgttttgttttcgggttccctccgcatgaacctg
gacccattcagccagtactcggacgaagaagtctggacgtccctggagctggcccacctg
aaggacttcgtgtcggcccttcctgacaagctggaccacgagtgtgcagaaggcggggag
aacctcagtgttgggcagcgccagcttgtgtgcctagcccgggcactgctgaggaagaca
aagatccttgtgttggatgaggccacggcggccgtggacctggaaacggacgacctcatc
cagtccaccatccggacgcagttcgaggactgcaccgtcctcaccatcgcccaccggctc
aacaccatcatggactacacaagggtgatcgtcttggacaaaggagaaatccaggagtac
ggcgccccctcggacctcctgcagcagagaggtcttttctacagcatggccaaagacgcc
ggcttggtgtga

DBGET integrated database retrieval system