KEGG   Pongo abelii (Sumatran orangutan): 100431942
Entry
100431942         CDS       T01416                                 

Gene name
DNM3
Definition
(RefSeq) dynamin-3 isoform X1
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04721  Synaptic vesicle cycle
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100431942 (DNM3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100431942 (DNM3)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100431942 (DNM3)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100431942 (DNM3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100431942 (DNM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100431942 (DNM3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100431942 (DNM3)
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100431942 (DNM3)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     100431942 (DNM3)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    100431942 (DNM3)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100431942 (DNM3)
   RhoA-dependent endocytosis
    100431942 (DNM3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100431942 (DNM3)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   100431942 (DNM3)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 TetR_C_27
Other DBs
NCBI-GeneID: 100431942
NCBI-ProteinID: XP_024104981
LinkDB
Position
1
AA seq 869 aa
MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQK
DIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
QGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGA
KINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLID
IQVSYINTNHEDFIGFANAQQRSSQVHKKTTIGNQGTNLPPSRQIVIRKGWLTISNIGIM
KGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR
NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVAENDENGQAENFSMDPQLERQVE
TIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAE
QAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRP
TLSAPLSRPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTR
APPSVPSRRPPPSPTRPTIIRPLESSLLD
NT seq 2610 nt   +upstreamnt  +downstreamnt
atggggaaccgggagatggaggagctcatcccgctggtgaaccgtctgcaggacgcgttt
tcggcgctgggacagagctgcctgctggagctgccgcagatcgccgtggtgggcggccag
agtgccggcaagagctcggtgctcgagaacttcgtgggcagggactttctccctcgaggg
tcgggcattgtaacaagacgacctcttgtgctgcagcttgttacttctaaagcagaatat
gctgagtttctacattgcaaaggaaagaaatttacagattttgatgaagttcgccatgag
attgaagcagaaacagatcgcgtgactggaatgaataaaggcatttcctccatacccatt
aatttacgagtctattccccacatgtgttaaatctaacccttattgatttacctggaata
actaaagtgcccgtgggagatcagccaccagatattgagtatcagatcagagaaatgatt
atgcagttcatcacgagggagaactgtctgattttagctgttactccagccaacactgat
cttgcaaactcagatgcactgaagctagctaaagaagttgatcctcaaggtctgagaacc
attggagttatcaccaaactggaccttatggatgaaggaacggatgccagggatgttcta
gagaacaaactgttgcctcttcgcaggggttacgtgggggtggtaaacagaagccagaag
gacatagatgggaagaaggacataaaggcagccatgctggcagagaggaagtttttcctt
tcccacccggcttacagacatatcgctgaccgaatgggaaccccacacctgcagaaggtc
cttaatcagcaacttaccaaccacattcgggataccctaccaaacttcaggaacaaacta
cagggacagttgctctccatagaacacgaagtagaagcctacaaaaatttcaaaccggaa
gacccaaccaggaagaccaaagcattgctgcagatggttcagcaatttgctgtggacttt
gagaagagaattgaagggtcaggggatcaagtagataccctggaactctcaggtggtgct
aaaatcaatcgtatttttcatgaacgctttccttttgagatagtaaagatggagttcaat
gagaaagaactgcgaagagaaataagctatgcaatcaaaaacatacatggtatcaggaca
gggttgtttactccagacatggcatttgaagcgatagtcaagaaacagattgtaaaattg
aaagggccttccttgaagagtgtggatctggtaatacaagaattgatcaacactgtgaag
aagtgtaccaaaaaactggcaaacttccccagactctgcgaggaaacggaaaggattgtt
gctaaccacattcgtgagcgagaagggaagacaaaggaccaggtattgctattgattgac
attcaagtctcttacatcaacaccaaccatgaagacttcattggcttcgcaaatgctcag
cagaggagcagtcaggttcacaagaaaaccacaattggaaatcagggaaccaatcttccg
ccttcaaggcaaattgtgattcgcaaggggtggctcaccatcagcaacattggcatcatg
aaaggcggctcaaagggatactggttcgtccttactgcggaaagcttgtcctggtataaa
gatgatgaggaaaaagaaaaaaagtacatgcttcccttggacaacctgaaagttcgggat
gtggaaaagagctttatgtctagcaagcacatctttgcactctttaacacagagcaaagg
aatgtatacaaagactatcgcttccttgagctggcatgtgattcccaggaggatgtcgac
agctggaaggcatctctactaagagctggggtctatcctgacaaatctgtagctgaaaat
gatgagaatggccaagcagaaaacttttccatggacccacaattggagaggcaagtggag
accattcgcaacctcgtagactcctacatgtccattatcaacaaatgtatccgagatcta
attccaaaaacaataatgcaccttatgatcaataacgttaaagatttcataaattcagag
ctcctagcacagttgtattcttcagaggaccaaaataccctgatggaggaatctgctgag
caggctcagcgccgggatgagatgcttcgaatgtaccaagccctgaaagaagcccttggg
ataattggggacatcagcacggccaccgtgtccactccggcaccccctccagtggatgat
tcctggatacagcactctcgcaggtcacctcctccaagccccacaacccaaaggaggcca
accctaagtgctcccctctcaaggcccacatccggccgaggaccagctcctgccattccc
tctcctggcccccactctggggctcccccagtcccattccgtccaggcccattacctcct
ttccccagcagcagtgactccttcggagcccctccacaagttccatctaggcccacgagg
gccccgcccagtgtcccaagccggagaccacccccatcaccaactcgtcccactataatc
cgcccactagaatcctctctgttagactaa

KEGG   Pongo abelii (Sumatran orangutan): 100442734
Entry
100442734         CDS       T01416                                 

Gene name
DNM2
Definition
(RefSeq) dynamin-2 isoform X1
  KO
K23484  dynamin 2 [EC:3.6.5.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04666  Fc gamma R-mediated phagocytosis
pon04721  Synaptic vesicle cycle
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100442734 (DNM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100442734 (DNM2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100442734 (DNM2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100442734 (DNM2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100442734 (DNM2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100442734 (DNM2)
   05100 Bacterial invasion of epithelial cells
    100442734 (DNM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100442734 (DNM2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100442734 (DNM2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     100442734 (DNM2)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    100442734 (DNM2)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100442734 (DNM2)
   RhoA-dependent endocytosis
    100442734 (DNM2)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   100442734 (DNM2)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 AAA_28
Other DBs
NCBI-GeneID: 100442734
NCBI-ProteinID: XP_024092414
LinkDB
Position
19
AA seq 870 aa
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGA
RINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL
KEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLID
IEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKE
YWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDL
RQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLV
DSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRD
DMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGR
PPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPP
GIPPGVPSRRPPAAPSRPTIIRPAEPSLLD
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgggcaaccgcgggatggaagagctgatcccgctggtcaacaaactgcaggacgccttc
agctccatcggccagagctgccacctggacctgccgcagatcgctgtggtgggcggccag
agtgccggcaagagctcggtgctggagaacttcgtgggccgggacttccttccccgcggt
tcaggaatcgtcacccggcggcctctcattctgcagctcatcttctcaaaaacagaacat
gccgagtttttgcactgcaagtccaaaaagtttacagactttgatgaagtccggcaggag
attgaagcagagaccgacagggtcacggggaccaacaaaggcatctccccagtgcccatc
aaccttcgagtctactcgccacacgtgttgaacttgaccctcatcgacctcccgggtatc
accaaggtgcccgtgggcgaccagcctccagacatcgaataccagatcaaggacatgatc
ctgcagttcatcagccgggagagcagcctcattctggctgtcacgcccgccaacatggac
ctggccaactccgacgccctcaagctggccaaggaggtcgatccccaaggcctacggacc
atcggtgtcatcaccaagcttgacctgatggacgagggcaccgacgccagggacgtcttg
gagaacaagttgctcccgttgagaagaggctacattggcgtggtgaaccgcagccagaag
gatattgagggcaagaaggacatccgtgcagcattggcagctgagaggaagttcttcctc
tcccacccggcctaccggcacatggccgaccgcatgggcacgccacatctgcagaagacg
ctgaatcagcaactgaccaaccacatccgggagtcgctgccggccctacgtagcaaacta
cagagccagctgctgtccctggagaaggaggtggaggagtacaagaacttccggcccgac
gaccccacccgcaaaaccaaagccctgctgcagatggtccagcagtttggggtggatttt
gagaagaggatcgagggctcaggagatcaggtggacacactggagctctccgggggcgcc
cgaatcaatcgcatcttccacgagcggttcccatttgagctggtgaagatggagtttgac
gagaaggacttacgacgggagatcagctatgccattaagaacatccatggagtcaggacc
gggcttttcaccccggacttggcattcgaggccattgtgaaaaagcaggtcgtcaagctg
aaagagccctgtctgaaatgtgtcgacctggttatccaggagctaatcaatacagttagg
cagtgtaccagtaagctcagttcctacccccggttgcgagaggagacagagcgaatcgtc
accacttacatccgggaacgggaggggagaaccaaggaccagattcttctgctgatcgac
attgagcagtcctacatcaacacgaaccatgaggacttcatcgggtttgccaatgcccag
cagaggagcacgcagctgaacaagaagagagccatccccaatcagggggagatcctggta
atccgcaggggctggctgaccatcaacaacatcagcctgatgaagggcggctccaaggag
tactggtttgtgctgactgccgagtcgctgtcctggtacaaggatgaggaggagaaagag
aagaagtacatgctgcctctggacaacctcaagatccgtgatgtggagaagggcttcatg
tccaacaagcacgtcttcgccatcttcaacacggagcagagaaacgtctacaaggacctg
cggcagatcgagctggcctgtgactcccaggaggacgtggacagctggaaggcctcgttc
ctccgagccggcgtctaccccgagaaggaccaggcagaaaacgaggatggggcccaggag
aacaccttctccatggacccccaactggagcggcaggtggagaccattcgcaacctggtg
gactcatatgtggccatcatcaacaagtccatccgcgacctcatgccaaagaccatcatg
cacctcatgatcaacaatacgaaggccttcatccaccacgagctgctggcttacctatac
tcctcggcggaccagagcagcctcatggaggagtcggccgaccaggcacagcggcgggat
gacatgctgcgcatgtaccatgccctcaaggaggcgctcaacatcatcggcgacatcagc
accagcactgtgtccacgcctgtacccccgcctgtcgatgacacctggctccagagcgcc
agcagccacagccccactccacagcgccgaccggtgtccagcatacacccccctggccgg
cccccagcggtgaggggccctactccagggccccccctgattcctgtgcccgtgggggca
gcagcctccttctcggcgcccccaatcccatcccggcctggaccccagagcgtgtttgcc
aacagtgacctcttcccagccccgcctcagatcccatctcggccagttcggatcccccca
gggattcccccaggagtgcccagcagaagaccccctgctgcgcccagccggcccaccatt
atacgcccagccgagccatccctgctcgactag

KEGG   Pongo abelii (Sumatran orangutan): 100446863
Entry
100446863         CDS       T01416                                 

Gene name
DNM1
Definition
(RefSeq) dynamin-1 isoform X1
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04721  Synaptic vesicle cycle
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100446863 (DNM1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100446863 (DNM1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100446863 (DNM1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100446863 (DNM1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100446863 (DNM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100446863 (DNM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100446863 (DNM1)
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100446863 (DNM1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     100446863 (DNM1)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    100446863 (DNM1)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100446863 (DNM1)
   RhoA-dependent endocytosis
    100446863 (DNM1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100446863 (DNM1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   100446863 (DNM1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1
Other DBs
NCBI-GeneID: 100446863
NCBI-ProteinID: XP_024107760
LinkDB
Position
9
AA seq 868 aa
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKI
REPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPSRKGPASPTRPAAPRPAEAPLLDL
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgggcaaccgcggcatggaagatctcattccgctggtcaaccggctgcaagacgccttc
tctgccataggccagaacgcggacctcgacctgccgcagatcgctgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaatttcgtaggcagggacttcctgcctcgagga
tctggcattgtcacccgacgtcccctggtcttgcagctggtcaatgcaaccacagaatat
gccgagttcctgcactgcaagggaaagaaattcaccgacttcgaggaggtgcgccttgaa
atcgaggccgagaccgaccgggtcaccggcaccaacaagggcatctcgccggtgcccatc
aacctccgcgtctactcgccgcacgtgctgaacctgaccctggtggacctgcccggaatg
accaaggtcccggtgggggaccaacctcccgacatcgagttccagatccgagacatgctt
atgcagtttgtcaccaaggagaactgcctcatcctggccgtgtcgcccgccaactctgac
ctggccaattctgacgccctcaaggtcgccaaggaagtggacccccagggccagcgcacc
atcggggtcatcaccaagctggacctgatggacgagggcacagatgcccgtgacgtgctg
gagaacaagctgctccccctgcgcagaggctacattggggtggtgaaccggagccagaag
gacattgatggcaagaaggacattaccgctgctttggctgctgaacgaaagttcttcctc
tcccatccatcttatcgccacttggctgaccgtatgggcacgccctacctgcagaaggtc
ctcaatcagcaactgacgaaccacatccgggacacgctgccggggcttcggaacaagctg
cagagccagctgctgtccattgagaaggaggtggaggagtacaagaacttccgccctgat
gacccagctcgcaagaccaaggccctgctgcagatggtccagcagttcgccgtagacttt
gagaagcgcattgagggctcaggagatcagatcgacacctatgaactgtcggggggagcc
cgcattaaccggatcttccatgagcgcttcccttttgagctggtcaagatggagtttgat
gagaaggaactccgaagggagatcagctatgctatcaagaatatccatggcattagaacg
gggctgtttaccccagacatggcctttgagaccattgtgaaaaagcaggtgaagaagatc
cgagaaccgtgtctcaagtgtgtggacatggttatctcggagctaatcagcaccgttaga
cagtgcaccaagaagctccagcagtacccgcggctgcgggaggagatggagcgcatcgtg
accacccacatccgggagcgcgagggccgcactaaggagcaggtcatgcttctcatcgat
atcgagctggcttatatgaacaccaaccatgaggacttcataggctttgccaatgctcag
cagaggagcaaccagatgaacaagaagaagacttcagggaaccaggatgagattctggtc
atccgcaagggctggctgactatcaataatattggcatcatgaaagggggctccaaggag
tactggtttgtgctgactgctgagaatctgtcctggtacaaggacgatgaggagaaagag
aagaaatacatgctgtctgtggacaacctcaagctgcgggacgtggagaagggcttcatg
tcgagcaagcacatctttgccctctttaacacagagcagaggaatgtctacaaggattat
cggcagctggagctggcctgtgagacacaggaggaggtggacagctggaaggcctccttc
ctgagagctggcgtgtaccctgagcgtgttggggacaaagagaaagccagcgagaccgag
gagaatggctccgacagcttcatgcattccatggacccacagctggaacggcaagtggag
accatccggaatcttgtggactcatacatggccattgtcaacaagaccgtgagggacctc
atgcccaagaccatcatgcacctcatgattaacaataccaaggagttcatcttctcggag
ctgctggccaacctgtactcgtgtggggaccagaacacgctgatggaggagtcggcggag
caggcacagcggcgcgacgagatgctgcgcatgtaccacgcgctgaaggaggcgctcagc
atcatcggcgacatcaacacgaccaccgtcagcacgcccatgcccccgcccgtggacgac
tcctggctgcaggtgcagagcgtaccggccggacgcaggtcacccacgtccagccccacg
ccgcagcgccgagcccccgccgtgcccccagcccggcccgggtcgcggggccctgctcct
gggcctccgcctgctgggtccgccctggggggggcgccccccgtgccctccaggccgggg
gcttcccctgaccctttcggccctccccctcaggtgccctcgcgccccaaccgcgccccg
cccggggtccccagcaggaagggcccagcctcacctacgcgacctgcagccccccgacca
gctgaggctcccctcttagacttataa

DBGET integrated database retrieval system