KEGG   Pongo abelii (Sumatran orangutan): 100431986Help
Entry
100431986         CDS       T01416                                 

Gene name
JAG1
Definition
(RefSeq) protein jagged-1
  KO
K06052  jagged-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04330  Notch signaling pathway
pon04371  Apelin signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04668  TNF signaling pathway
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100431986 (JAG1)
   04371 Apelin signaling pathway
    100431986 (JAG1)
   04668 TNF signaling pathway
    100431986 (JAG1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100431986 (JAG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431986 (JAG1)
  09162 Cancer: specific types
   05224 Breast cancer
    100431986 (JAG1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100431986 (JAG1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100431986 (JAG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100431986 (JAG1)
CD molecules [BR:pon04090]
 Proteins
  100431986 (JAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3 MAP17 DUF2920
Motif
Other DBs
NCBI-GeneID: 100431986
NCBI-ProteinID: XP_002829998
Ensembl: ENSPPYG00000010708
UniProt: H2P116
LinkDB All DBs
Position
20
AA seq 1218 aa AA seqDB search
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICA
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccccacggacgcgcggccggcccgggcgccccctaagcctcctgctcgccctg
ctctgtgccctgcgagccaaggtgtgtggggcctcgggtcagttcgagttggagatcctg
tccatgcagaacgtgaacggggagctgcagaacgggaactgctgcggcggcgcccggaac
ccgggagaccgcaagtgcacccgcgacgagtgtgacacatacttcaaagtgtgcctcaag
gagtatcagtcccgcgtcacggccggggggccctgcagcttcggctcagggtccacgcct
gtcatcgggggcaacaccttcaacctcaaggccagccgcggcaacgaccgcaaccgcatc
gtgctgcctttcagtttcgcctggccgaggtcctatacgttgcttgtggaggcatgggat
tccagtaatgacaccgttcaacctgacagtattattgaaaaggcttcccactcgggcatg
atcaaccccagccgacagtggcagacgctgaagcagaacacgggcgttgcccactttgag
tatcagatccgcgtgacctgtgatgactactactatggctttggctgcaataagttctgc
cgccccagagatgacttctttggacactatgcctgtgaccagaatggcaacaaaacttgc
atggaaggctggatgggccctgaatgtaacagagctatttgccgacaaggctgcagtccc
aagcatgggtcttgcaaactcccgggtgactgcaggtgccagtacggctggcaaggcctg
tactgtgataagtgcatcccgcacccgggatgcgtccatggcatctgtaatgagccctgg
cagtgcctctgtgagaccaactggggcggccagctctgtgacaaagatctcaattactgt
gggacccatcagccgtgtctcaacgggggaacttgtagcaacacaggccctgacaaatat
cagtgttcctgccctgaggggtattcaggacccaactgtgaaattgctgagcacgcctgc
ctctctgatccctgtcacaacagaggcagctgtaaggagacctccctgggctttgagtgt
gagtgttccccaggctggaccggccccacatgctctacaaacattgatgactgttctcct
aataactgttcccacgggggcacctgccaggacctggttaacggatttaagtgtgtgtgc
cccccacagtggactgggaaaacgtgccagttagatgcaaatgaatgtgaggccaaacct
tgtgtaaacgccaaatcctgtaagaatctcattgccagctactactgcgactgtcttccc
ggctggatgggtcagaattgtgacataaatattaatgactgccttggccagtgtcagaat
gacgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcattgtgagagagacatcgatgaatgtgccagcaacccctgtttgaatgggggt
cactgtcagaatgaaatcaacagattccagtgtctgtgtcccactggtttctctggaaac
ctctgtcagttggacattgattattgtgagcctaatccctgccagaatggtgcccagtgc
tacaaccgtgccagcgactatttctgcaagtgccccgaggactatgagggcaagaactgc
tcacacctgaaagaccactgccgcacgaccccctgtgaagtgattgacagctgcacagtg
gccatggcttccaacgacacacctgaaggggtgcggtatatttcctccaacgtctgtggt
cctcacgggaagtgcaagagtcagtcgggaggcaaattcacctgtgactgtaacaaaggc
ttcacgggaacatactgccatgaaaatattaatgactgtgagagcaacccttgtagaaac
ggtggcacttgcatcgatggtgtcaactcctacaagtgcatctgtagtgacggctgggag
ggggcctactgtgaaaccaatattaatgactgcagccagaacccctgccacaatgggggc
acgtgtcgcgacctggtcaacgacttctactgtgactgtaaaaatgggtggaaaggaaag
acctgccactcacgtgacagtcagtgtgacgaggccacatgcaacaacggtggcacctgc
tatgatgagggggatgcttttaagtgcatgtgtcctggcggctgggaaggaaccacctgt
aacatagcccgaaacagtagctgcctgcccaacccctgccataatgggggcacatgtgtg
gtcaacggcgagtcctttacgtgtgtctgcaaggaaggctgggaggggcccatctgtgct
cagaataccaatgactgcagccctcatccctgttacaacagcggcacctgtgtggatgga
gacaactggtaccggtgcgaatgtgccccgggttttgctgggcccgactgcagaataaac
atcaatgaatgccagtcttcaccttgtgcctttggagcaacctgtgtggatgagatcaac
ggctaccggtgtgtctgccctccagggcacagtggtgccaagtgccaggaagtttcaggg
agaccttgcatcaccatggggagtgtgataccagatggggccaaatgggatgacgactgt
aatacctgccagtgcctgaatggacggatcgcctgctcaaaggtctggtgtggccctcga
ccttgcctgctccacaaagggcacagcgagtgccccagcgggcagagctgcatccccatc
ctggatgaccagtgcttcgtccacccctgcactggtgtgggcgagtgtcggtcttccagt
ctccagccagtgaagacgaagtgcacctctgactcctattaccaggataactgtgcgaac
atcacatttacctttaacaaggagatgatgtcaccaggtcttactacggagcacatttgc
agtgaattgaggaatttgaatattttgaagaatgtttctgctgaatattcaatctacatc
gcttgtgagccttccccttcagcgaacaatgaaatacatgtggccatttctgctgaagat
atacgggatgatgggaacccgatcaaggaaatcactgacaaaataatcgatcttgttagt
aaacgtgatggaaacagctcgctgattgctgccgttgcagaagtaagagttcagaggcgg
cctctgaagaacagaacagatttccttgttcccttgctgagctctgtcttaactgtggct
tggatctgttgcttggtgacggccttctactggtgcctgcggaagcggcggaagccgggc
agccacacacactcagcctctgaggacaacaccaccaacaacgtgcgggagcagctgaac
cagatcaaaaaccccattgagaaacatggggccaacacggtccccatcaaggattatgag
aacaagaactccaaaatgtctaaaataaggacacacaattctgaagtagaagaggacgac
atggacaaacaccagcagaaagcccggtttgccaagcagccggcatacacgctggtagac
agagaagagaagccccccaacggcacgccgacaaaacacccaaactggacaaacaaacag
gacaacagagacttggaaagtgcccagagcttaaaccgaatggagtacatcgtatag

KEGG   Pongo abelii (Sumatran orangutan): 100447370Help
Entry
100447370         CDS       T01416                                 

Gene name
JAG2
Definition
(RefSeq) protein jagged-2 isoform X1
  KO
K21635  jagged-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04330  Notch signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon05200  Pathways in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100447370 (JAG2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100447370 (JAG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447370 (JAG2)
  09162 Cancer: specific types
   05224 Breast cancer
    100447370 (JAG2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100447370 (JAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF MNNL DSL EGF_2 EGF_CA
Motif
Other DBs
NCBI-GeneID: 100447370
NCBI-ProteinID: XP_024087317
LinkDB All DBs
Position
14
AA seq 1238 aa AA seqDB search
MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVN
GYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLC
EPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGT
AASGVCGPHGRCISQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRC
FCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT
CSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDG
WEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSQGTPFPHGSSWVEDCNSCRCLDGRRD
CSKVWCGWKPCLLAGQPEVLSAQCPPGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCL
PRSGHLDNNCARLTLRFNRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSG
ASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGNSSLLLAVTEVKVETVVMGGSST
GLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLPREESTNNQWAPLNPIRNPIER
PGGHKDVLYQCKNFTPPPRRADEALPGPAGHAGVREDEEDEDLGRGEEDSLEAEKFLSHK
FTKDPGRSPGRPAHWASGPKVDNRVVRSINEARYTGKE
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgcagggccgggggcgcttgccccggcggctgctgctgctgctggcgctctgg
gtgcaggcggcgcggcccatgggctatttcgagctgcagctgagcgcgctgcggaacgtg
aacggggagctgctgagcggcgcctgctgtgacggcgacggccggacaacgcgcgcgggg
ggctgcggccacgacgagtgcgacacgtacgtgcgcgtgtgccttaaggagtaccaggcc
aaggtgacgcccacggggccctgcagctacggccacggcgccacgcccgtgctgggcggc
aactccttctacctgccgccggcgggcgctgcgggggaccgagcgcgggcgcgggcccgg
gccggcggcgaccaggacccgggcctcgtcgtcatccccttccagttcgcctggccgcgc
tccttcaccctcatcgtggaggcctgggattgggacaacgataccaccccgaatgaggag
ctgctgatcgagcgagtgtcgcatgccggcatgatcaacccggaggaccgttggaagagc
ctgcacttcagcggccacgtggcgcacctggagctacagatccgtgtgcgctgcgacgag
aactactacagtgccacctgcaacaagttctgccggccccgcaacgactttttcggccac
tacacctgcgaccagtatggcaacaaggcctgcatggatggctggatgggcaaggagtgc
aaggaagccgtgtgtaaacaagggtgtaatttgctccacgggggatgcaccgtgcctggg
gagtgcaggtgcagctacggctggcaagggaggttctgcgatgagtgtgtcccatacccc
ggctgcgtgcatggcagttgtgtggagccctggcagtgcaactgtgagaccaactggggc
ggcctgctctgcgacaaagacctgaactactgtggcagccaccacccctgcaccaacgga
ggcacatgcatcaacgctgagcccgaccagtaccgctgcacctgccctgacggctactcg
ggcaggaactgtgagaaggctgagcacgcctgcacctccaacccatgtgccaatgggggc
tcttgccatgaggtgccatctggcttcgaatgccactgcccatcgggctggagcgggccc
acctgtgcccttgacatcgatgagtgtgcttcgaacccatgtgcggccggtggcacctgt
gtggaccaggtggatggcttcgagtgcatctgccccgagcagtgggtgggggccacctgc
cagctggacgccaatgagtgtgaagggaagccgtgccttaacgctttttcttgcaaaaac
ctgattggcggctattactgtgattgcatcccgggctggaagggcatcaactgccacatc
aacgtcaacgactgtcgcgggcagtgtcagcacgggggcacctgcaaggacctggtgaac
gggtaccagtgtgtgtgcccgcggggcttcggaggccggcattgcgagctggaacgagac
gagtgtgccagcagcccctgccacagcggcggcctgtgcgaggacctggccgacggcttc
cactgccactgcccccagggcttctccgggcctctctgtgaggtggatgtcgacctttgt
gagccgagcccctgccggaacggcgcccgctgctataacctggagggtgactattactgc
gcctgccctgatgacttcggtggcaagaactgctccgtgccccgcgagccgtgccctggc
ggggcctgcagagtgatcgatggctgcgggtcagatgcagggcctgggatgcctggcaca
gcagcctccggcgtgtgtggcccccacggacgctgcatcagccagccagggggcaacttt
tcctgcatctgtgacagcggcttcactggcacctactgccatgagaacattgacgactgc
ctgggccagccctgccgcaatgggggcacgtgcatcgacgaggtggacgccttccgctgc
ttctgccccagtggctgggagggcgagctctgcgacaccaatcccaacgactgccttccc
gatccctgccacagccgcggccgctgctacgacctggtcaatgacttctactgcgcgtgc
gacgacggctggaagggcaagacttgccactcacgcgagttccagtgcgacgcctacacc
tgcagcaacggcggcacctgctacgacagcggcgacaccttccgctgcgcctgccccccc
ggctggaagggcagcacctgcgctgtcgccaagaacagcagctgcctgcccaacccctgt
gtgaatgggggcacctgcgtgggcagcggggcctccttctcctgcatctgccgggacggc
tgggagggtcgtacttgcactcacaataccaacgactgcaaccctctgccttgctacaat
ggtggcatctgtgttgacggcgtcaactggttccgctgcgagtgtgctcctggcttcgcg
gggcctgactgccgcatcaacatcgacgagtgccagtcctcgccctgtgcctatggggcc
acgtgtgtggatgagatcaacgggtatcgctgtagctgcccacccggccgagccggcccc
cggtgccaggaagtgatcgggttcggaaggtcctgctggtcccagggcactccattccca
cacggaagctcctgggtggaagactgcaacagctgccgctgcctggatggccgccgtgac
tgcagcaaggtgtggtgtggatggaagccttgtctgctggctggccagcccgaggtcctg
agcgcccagtgcccgccggggcaaaggtgcctggagaaggccccaggccagtgtctgcga
ccaccctgtgaggcctggggggagtgcggtgcagaagagccaccgagcaccccctgcctg
ccacgctccggccacctggacaataactgtgcccgcctcaccttgcgtttcaaccgtgac
cacgtgccccagggcaccacggtgggcgccatttgctccgggatccgctccctgccagcc
acaagggctgtggcacgggaccgcctgctggtgttgctttgcgaccgggcgtcctcgggg
gccagtgctgtggaggtggccgtgtccttcagccctgccagggacctgcctgacagcagc
ctgatccagggcgcggcccatgccatcgtggccgccatcacccagcgggggaacagctca
ctgctcttggctgtcaccgaggtcaaagtggagacggttgttatgggcggctcttccaca
ggtctgctggtgcccgtgctgtgtggtgccttcagcgtgctgtggctggcgtgcgtggtc
ctgtgcgtgtggtggacacgcaagcgcaggaaagagcgggagaggagccggctgccgcgg
gaggagagcaccaacaaccagtgggccccgctcaaccccatccgcaaccccatcgagcgg
ccagggggccacaaggatgtgctctaccagtgcaagaacttcacgccgccgccgcgcagg
gcggacgaggcgttgcccgggccggccggccacgcgggcgtcagggaggatgaggaggac
gaggatctgggccgcggtgaggaggactccctggaggcggagaagttcctctcacacaaa
ttcaccaaagatcctggccgctcgccggggaggccggcccactgggcctcaggccccaaa
gtggacaaccgcgtggtcaggagcatcaatgaggcccgctacaccggcaaggagtag

DBGET integrated database retrieval system