KEGG   Pongo abelii (Sumatran orangutan): 100432001
Entry
100432001         CDS       T01416                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04141  Protein processing in endoplasmic reticulum
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05160  Hepatitis C
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100432001 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100432001 (BAK1)
   04215 Apoptosis - multiple species
    100432001 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432001 (BAK1)
   05202 Transcriptional misregulation in cancer
    100432001 (BAK1)
   05206 MicroRNAs in cancer
    100432001 (BAK1)
   05203 Viral carcinogenesis
    100432001 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100432001 (BAK1)
   05212 Pancreatic cancer
    100432001 (BAK1)
   05225 Hepatocellular carcinoma
    100432001 (BAK1)
   05226 Gastric cancer
    100432001 (BAK1)
   05214 Glioma
    100432001 (BAK1)
   05216 Thyroid cancer
    100432001 (BAK1)
   05220 Chronic myeloid leukemia
    100432001 (BAK1)
   05217 Basal cell carcinoma
    100432001 (BAK1)
   05218 Melanoma
    100432001 (BAK1)
   05213 Endometrial cancer
    100432001 (BAK1)
   05224 Breast cancer
    100432001 (BAK1)
   05222 Small cell lung cancer
    100432001 (BAK1)
   05223 Non-small cell lung cancer
    100432001 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100432001 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100432001 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100432001 (BAK1)
   05160 Hepatitis C
    100432001 (BAK1)
   05164 Influenza A
    100432001 (BAK1)
   05162 Measles
    100432001 (BAK1)
   05168 Herpes simplex virus 1 infection
    100432001 (BAK1)
   05163 Human cytomegalovirus infection
    100432001 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100432001 (BAK1)
   05169 Epstein-Barr virus infection
    100432001 (BAK1)
   05165 Human papillomavirus infection
    100432001 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100432001 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pon03029]
    100432001 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100432001 (BAK1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100432001 (BAK1)
Transporters [BR:pon02000]
 Other transporters
  Pores ion channels [TC:1]
   100432001 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 100432001
NCBI-ProteinID: XP_024104939
Ensembl: ENSPPYG00000016502
LinkDB
Position
6
AA seq 211 aa
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTHFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccgggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggcggctgcccctgccgacccagagatg
gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttacagcacctg
cagcccacggcagagaatgcctatgagtacttcaccaagattgcctccagcctgtttgag
agtggcatcaactggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcgcggcctgactggcttcctgggccaggtgacgcacttcgtggtcgac
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

KEGG   Pongo abelii (Sumatran orangutan): 100460189
Entry
100460189         CDS       T01416                                 

Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04141  Protein processing in endoplasmic reticulum
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05160  Hepatitis C
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100460189
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100460189
   04215 Apoptosis - multiple species
    100460189
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460189
   05202 Transcriptional misregulation in cancer
    100460189
   05206 MicroRNAs in cancer
    100460189
   05203 Viral carcinogenesis
    100460189
  09162 Cancer: specific types
   05210 Colorectal cancer
    100460189
   05212 Pancreatic cancer
    100460189
   05225 Hepatocellular carcinoma
    100460189
   05226 Gastric cancer
    100460189
   05214 Glioma
    100460189
   05216 Thyroid cancer
    100460189
   05220 Chronic myeloid leukemia
    100460189
   05217 Basal cell carcinoma
    100460189
   05218 Melanoma
    100460189
   05213 Endometrial cancer
    100460189
   05224 Breast cancer
    100460189
   05222 Small cell lung cancer
    100460189
   05223 Non-small cell lung cancer
    100460189
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100460189
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100460189
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100460189
   05160 Hepatitis C
    100460189
   05164 Influenza A
    100460189
   05162 Measles
    100460189
   05168 Herpes simplex virus 1 infection
    100460189
   05163 Human cytomegalovirus infection
    100460189
   05167 Kaposi sarcoma-associated herpesvirus infection
    100460189
   05169 Epstein-Barr virus infection
    100460189
   05165 Human papillomavirus infection
    100460189
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100460189
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pon03029]
    100460189
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100460189
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100460189
Transporters [BR:pon02000]
 Other transporters
  Pores ion channels [TC:1]
   100460189
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 PTPS
Other DBs
NCBI-GeneID: 100460189
NCBI-ProteinID: XP_002824361
LinkDB
Position
13
AA seq 215 aa
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSNVFHRHQQEQEAEGAAAPADPEM
VTLPLCNLAGPCSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENTCEYFTKIAS
SLFESGINWGRVVALLGFGYRLALHVYHRGLTGFLGQVTRFVVDFMLHHCIARWIAQRGG
WVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccgggacacagaggaggttttccgcagcaacgttttt
caccgccatcagcaggaacaggaggctgaaggggcggctgcccctgccgacccagagatg
gtcaccttacctctctgcaacctagcaggaccctgtagcaccatggggcaggtgggacgg
cagctcgccatcatcggggacgacatcaaccgacgctatgactcagagttccagaccatg
ttacagcacctgcagcccacggcagagaatacctgtgagtacttcaccaagattgcctcc
agcctttttgagagtggcatcaattggggccgtgtggtggctcttctgggcttcggctac
cgtctggccctacacgtctaccatcgcggcctgactggcttcctgggccaggtgacgcgc
ttcgtggtcgacttcatgctgcatcactgcattgcccggtggattgcacagaggggtggc
tgggtggcagccctgaacttgggcaatggtcccattctgaacgtgctggtggttctgggt
gtggttctgttgggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system