KEGG   Pongo abelii (Sumatran orangutan): 100432100
Entry
100432100         CDS       T01416                                 

Gene name
KNG1
Definition
(RefSeq) kininogen-1 isoform X1
  KO
K03898  kininogen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04071  Sphingolipid signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04610  Complement and coagulation cascades
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100432100 (KNG1)
   04022 cGMP-PKG signaling pathway
    100432100 (KNG1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100432100 (KNG1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100432100 (KNG1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100432100 (KNG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100432100 (KNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432100 (KNG1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100432100 (KNG1)
   05143 African trypanosomiasis
    100432100 (KNG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100432100 (KNG1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100432100 (KNG1)
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I25: cystatin family
   100432100 (KNG1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100432100 (KNG1)
  Exosomal proteins of other cancer cells
   100432100 (KNG1)
SSDB
Motif
Pfam: Cystatin Cathelicidins Spp-24 Bradykinin
Other DBs
NCBI-GeneID: 100432100
NCBI-ProteinID: XP_002814433
LinkDB
Position
3
AA seq 643 aa
MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT
EVTKMVGSDTFYSFKYEIKEGDCPVQSGKTWQDCDYKDAAEAATAECTATVAKRGSKKFS
VATQTCRMTPAEGPVVTAQYDCLGCVHPVSTQSPDLEPILRHGIQYFNNNTQHSSLFTLN
EVKRAQRQVVAGLNFQITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLR
IASFSQKCDIYPGEDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
IDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPW
EKKIYPTVNCQPLGMISLMKRPPGFSPFRSSQIGEIKEGTTVSPPHTSMAPAQDEERDSG
KEQGHTHRHDWGHEKQRKHNLGLGHKHEGDQGHGHQRGHGLGRGHQQQHGLGHGRKFKLD
DDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQE
KTEGPTPIPSLAQPGVTVTFSDFQDSDLIATMMPPIPPPPTESDDDWIPDIQIDPNGLSF
NPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYFNLADALS
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgaaactaattaccatccttttcctctgctccaggctgctactaagtttaacccaggaa
tcacagtccgaggaaattgactgcaatgacaaggatttatttaaagctgtggatgctgct
ctgaagaaatataacagtcaaaaccaaagtaacaaccagtttgtattgtaccgcataact
gaagtcactaagatggttggctctgacacgttttattccttcaagtacgaaatcaaggag
ggggattgtcctgttcaaagtggcaaaacctggcaggactgtgactacaaggatgctgca
gaagcagccactgcagagtgcaccgcaactgtggcgaagaggggcagcaagaaattctcc
gtggctacccagacctgccggatgactccagccgagggccctgtggtgacagcccagtac
gactgcctcggctgtgtgcatcctgtatcaacgcagagcccagacctggagcccattctg
agacatggcattcagtactttaacaacaacactcaacattcctccctcttcacgcttaat
gaagtaaaacgggcccaaagacaggtggtggctggattgaactttcaaattacctactca
attgtgcaaacgaattgttccaaagagaattttctgttcttaactccagactgcaagtcc
ctttggaatggtgataccggtgaatgtacagataatgcatacatcgatattcagctacga
attgcttccttctcacagaaatgtgacatttatccaggggaggattttgtacaaccacct
accaagatttgcgtgggctgccccagagatatacccaccaacagcccagagctggaggag
acactgactcacaccatcacaaagcttaatgcagagaataacgcaactttctatttcaag
attgacaatgtgaaaaaagcaagagtacaggtggtggctggcaagaaatattttattgac
ttcgtggccagggaaaccacgtgttccaaggaaagtaatgaagagttgaccgaaagctgt
gagaccaaaaaacttggccaaagcctagattgcaatgctgaagtttatgtggtaccctgg
gagaaaaaaatttaccctactgtcaactgtcaaccactgggaatgatctcactgatgaaa
aggcctccaggtttttcacctttccgatcatcacaaataggggaaataaaagaaggaaca
actgtaagtccaccccacacttccatggcacctgcacaagatgaagagcgggattcagga
aaagaacaagggcatactcatagacatgactggggccatgaaaaacaaagaaaacataat
cttggcctcggccataaacatgaaggtgaccaagggcatgggcaccaaagaggacatggc
cttggccgtggacaccaacaacagcatggtcttggtcatggacgtaagttcaaacttgat
gatgatcttgaacaccaagggggccatgttcttgaccatggacataagcataagcatggt
catggccatggaaaacataaaaataaaggcaaaaagaatggaaagcacaatggttggaaa
acagagcatttggcaagctcttctgaagatagcactacaccttctgcacagacacaagag
aagacagaagggccaacccccatcccttccctagcccagccaggtgtaacagttaccttt
tctgactttcaggactctgatctcattgcaactatgatgcctcctataccaccgcctccc
acagagagtgatgatgattggatccctgatatccagatagacccaaatggcctttcattt
aacccgatatcagattttccagacacaacctccccaaaatgtcctggacgcccctggaag
tcagttagtgaaattaatccaaccacacaaatgaaagaatcctatttcaatcttgctgat
gccctttcttaa

DBGET integrated database retrieval system