Pongo abelii (Sumatran orangutan): 100432153 Help Entry 100432153         CDS       T01416                                  Definition (RefSeq) interferon alpha-1/13   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100432153    04151 PI3K-Akt signaling pathway     100432153   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100432153  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100432153  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100432153    04621 NOD-like receptor signaling pathway     100432153    04622 RIG-I-like receptor signaling pathway     100432153    04623 Cytosolic DNA-sensing pathway     100432153    04650 Natural killer cell mediated cytotoxicity     100432153  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100432153   09163 Immune disease    05320 Autoimmune thyroid disease     100432153   09171 Infectious disease: bacterial    05152 Tuberculosis     100432153   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100432153    05161 Hepatitis B     100432153    05160 Hepatitis C     100432153    05171 Coronavirus disease - COVID-19     100432153    05164 Influenza A     100432153    05162 Measles     100432153    05168 Herpes simplex virus 1 infection     100432153    05163 Human cytomegalovirus infection     100432153    05167 Kaposi sarcoma-associated herpesvirus infection     100432153    05169 Epstein-Barr virus infection     100432153    05165 Human papillomavirus infection     100432153  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100432153 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100432153 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon APC1_C Motif Other DBs NCBI-GeneID:  100432153 NCBI-ProteinID:  XP_002819786 UniProt:  A0A2J8XIS4 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MASPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRLDFG FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDEFCTELYQQLNDLE ACVMQEERVGETPLINADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcctcaccctttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc tctctgggctgtgatctgcctgagacccacagcctggataacaggaggaccttgatgctc ctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacttgactttgga tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc catgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgcttgg gatgaggacctcctagacgaattctgcactgaactctaccagcagctgaatgacttggaa gcctgtgtgatgcaggaggagagggtgggagaaactcccctgataaatgcggactccatc ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaattatgagatccctctctttatcaacaaac ttgcaagaaagattaaggaggaaggaataa

Pongo abelii (Sumatran orangutan): 100432532 Help Entry 100432532         CDS       T01416                                  Gene name IFNA8 Definition (RefSeq) interferon alpha-8   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100432532 (IFNA8)    04151 PI3K-Akt signaling pathway     100432532 (IFNA8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100432532 (IFNA8)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100432532 (IFNA8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100432532 (IFNA8)    04621 NOD-like receptor signaling pathway     100432532 (IFNA8)    04622 RIG-I-like receptor signaling pathway     100432532 (IFNA8)    04623 Cytosolic DNA-sensing pathway     100432532 (IFNA8)    04650 Natural killer cell mediated cytotoxicity     100432532 (IFNA8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100432532 (IFNA8)   09163 Immune disease    05320 Autoimmune thyroid disease     100432532 (IFNA8)   09171 Infectious disease: bacterial    05152 Tuberculosis     100432532 (IFNA8)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100432532 (IFNA8)    05161 Hepatitis B     100432532 (IFNA8)    05160 Hepatitis C     100432532 (IFNA8)    05171 Coronavirus disease - COVID-19     100432532 (IFNA8)    05164 Influenza A     100432532 (IFNA8)    05162 Measles     100432532 (IFNA8)    05168 Herpes simplex virus 1 infection     100432532 (IFNA8)    05163 Human cytomegalovirus infection     100432532 (IFNA8)    05167 Kaposi sarcoma-associated herpesvirus infection     100432532 (IFNA8)    05169 Epstein-Barr virus infection     100432532 (IFNA8)    05165 Human papillomavirus infection     100432532 (IFNA8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100432532 (IFNA8) Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100432532 (IFNA8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100432532 NCBI-ProteinID:  XP_002819787 Ensembl:  ENSPPYG00000019174 UniProt:  H2PS16 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALVLLAQMKRISPFSCLKDRRDFG FPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKNSSAALDETLLDEFYIELDQQLNNLE SCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLAEKKYSSCAWEVVRAEIMRSFSLSIN LQKRLKSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgactttttatttactggtggccctagtggtgctcagctacaagtcattcagc tctctgggctgtgatctgcctcagactcacagcctgggtaacaggagggccttggtgctc ctggcacaaatgaaaagaatctctcctttctcctgcctgaaggacagacgtgactttgga ttcccccaggaggagtttgatgataaacagttccagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaacctcttcagcacaaagaattcatctgctgctttg gatgagacccttctagatgaattctacatcgaacttgaccagcagctgaataacctggag tcctgtgtgatgcaggaagtgggggtgatagagtctcccctcatgtacgaggactccatc ttggctgtgaggaaatacttccaaagaatcactctatatctggcagagaagaaatacagc tcttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac ttgcaaaaaagattgaagagtaaggaatga

Pongo abelii (Sumatran orangutan): 100432906 Help Entry 100432906         CDS       T01416                                  Gene name IFNA2 Definition (RefSeq) interferon alpha-2   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100432906 (IFNA2)    04151 PI3K-Akt signaling pathway     100432906 (IFNA2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100432906 (IFNA2)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100432906 (IFNA2)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100432906 (IFNA2)    04621 NOD-like receptor signaling pathway     100432906 (IFNA2)    04622 RIG-I-like receptor signaling pathway     100432906 (IFNA2)    04623 Cytosolic DNA-sensing pathway     100432906 (IFNA2)    04650 Natural killer cell mediated cytotoxicity     100432906 (IFNA2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100432906 (IFNA2)   09163 Immune disease    05320 Autoimmune thyroid disease     100432906 (IFNA2)   09171 Infectious disease: bacterial    05152 Tuberculosis     100432906 (IFNA2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100432906 (IFNA2)    05161 Hepatitis B     100432906 (IFNA2)    05160 Hepatitis C     100432906 (IFNA2)    05171 Coronavirus disease - COVID-19     100432906 (IFNA2)    05164 Influenza A     100432906 (IFNA2)    05162 Measles     100432906 (IFNA2)    05168 Herpes simplex virus 1 infection     100432906 (IFNA2)    05163 Human cytomegalovirus infection     100432906 (IFNA2)    05167 Kaposi sarcoma-associated herpesvirus infection     100432906 (IFNA2)    05169 Epstein-Barr virus infection     100432906 (IFNA2)    05165 Human papillomavirus infection     100432906 (IFNA2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100432906 (IFNA2) Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100432906 (IFNA2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CBF APC1_C DDHD Motif Other DBs NCBI-GeneID:  100432906 NCBI-ProteinID:  XP_002819788 Ensembl:  ENSPPYG00000019175 UniProt:  A0A663DA02 H2PS17 LinkDB All DBs Position 9 AA seq 188 aa AA seqDB search MALTFALLVTLLVLSCKSSCSLGCDLPQTHSLGNRRTLMLLAQMRRLSLFSCLKDRHDFG FPQEEFGNQFQKAQTIPVLHEMIQQIFNLFSTKDSCAAWDETLLDKFYTELYQQLNDLED CVMQEVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVREEIMRSFSLSTNL QESLRSKE NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggccttgacctttgctttactggtgaccctcctggtgctcagctgcaagtcaagctgc tctctgggctgtgatctgcctcaaacccacagcctgggtaacaggaggaccttgatgctc ctggcacaaatgaggagactctctcttttctcctgcttgaaggacagacatgactttgga tttccccaggaggagtttggcaaccagttccaaaaggctcaaaccatccctgtcctccat gagatgatccagcagatcttcaatctcttcagcacaaaggactcatgtgctgcttgggat gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagac tgtgtgatgcaggaggtgggggtgacagagactcccctgatgaaggaggactccattctg gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct tgtgcctgggaggttgtcagagaagaaatcatgagatctttttctttgtcaacaaacttg caagaaagtttaagaagtaaggaatga

Pongo abelii (Sumatran orangutan): 100433301 Help Entry 100433301         CDS       T01416                                  Definition (RefSeq) interferon alpha-1/13-like   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100433301    04151 PI3K-Akt signaling pathway     100433301   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100433301  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100433301  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100433301    04621 NOD-like receptor signaling pathway     100433301    04622 RIG-I-like receptor signaling pathway     100433301    04623 Cytosolic DNA-sensing pathway     100433301    04650 Natural killer cell mediated cytotoxicity     100433301  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100433301   09163 Immune disease    05320 Autoimmune thyroid disease     100433301   09171 Infectious disease: bacterial    05152 Tuberculosis     100433301   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100433301    05161 Hepatitis B     100433301    05160 Hepatitis C     100433301    05171 Coronavirus disease - COVID-19     100433301    05164 Influenza A     100433301    05162 Measles     100433301    05168 Herpes simplex virus 1 infection     100433301    05163 Human cytomegalovirus infection     100433301    05167 Kaposi sarcoma-associated herpesvirus infection     100433301    05169 Epstein-Barr virus infection     100433301    05165 Human papillomavirus infection     100433301  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100433301 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100433301 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100433301 NCBI-ProteinID:  XP_002819789 Ensembl:  ENSPPYG00000019176 UniProt:  A0A663D6T6 H2PS18 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALPFALLMALVVLSCKSSCSLGCDLPETHNLDNRRTLMLLTQRSRISPSSCLMDRHDFV FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDEFCTELYQQLNDLE ACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgccctttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc tctctgggctgtgatctgcctgagacccacaacctggataacaggaggaccttgatgctc ctgacacaaaggagcagaatctctccttcctcctgtctgatggacagacatgactttgta tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc catgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgcttgg gatgaggacctcctagacgaattctgcactgaactctaccagcagctgaatgacttggaa gcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactccatc ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaacaaac ttgcaagaaagattaaggaggaaggaataa

Pongo abelii (Sumatran orangutan): 100434036 Help Entry 100434036         CDS       T01416                                  Gene name IFNA6 Definition (RefSeq) interferon alpha-6   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100434036 (IFNA6)    04151 PI3K-Akt signaling pathway     100434036 (IFNA6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100434036 (IFNA6)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100434036 (IFNA6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100434036 (IFNA6)    04621 NOD-like receptor signaling pathway     100434036 (IFNA6)    04622 RIG-I-like receptor signaling pathway     100434036 (IFNA6)    04623 Cytosolic DNA-sensing pathway     100434036 (IFNA6)    04650 Natural killer cell mediated cytotoxicity     100434036 (IFNA6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100434036 (IFNA6)   09163 Immune disease    05320 Autoimmune thyroid disease     100434036 (IFNA6)   09171 Infectious disease: bacterial    05152 Tuberculosis     100434036 (IFNA6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100434036 (IFNA6)    05161 Hepatitis B     100434036 (IFNA6)    05160 Hepatitis C     100434036 (IFNA6)    05171 Coronavirus disease - COVID-19     100434036 (IFNA6)    05164 Influenza A     100434036 (IFNA6)    05162 Measles     100434036 (IFNA6)    05168 Herpes simplex virus 1 infection     100434036 (IFNA6)    05163 Human cytomegalovirus infection     100434036 (IFNA6)    05167 Kaposi sarcoma-associated herpesvirus infection     100434036 (IFNA6)    05169 Epstein-Barr virus infection     100434036 (IFNA6)    05165 Human papillomavirus infection     100434036 (IFNA6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100434036 (IFNA6) Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100434036 (IFNA6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon MAS20 Motif Other DBs NCBI-GeneID:  100434036 NCBI-ProteinID:  XP_002819791 Ensembl:  ENSPPYG00000019178 UniProt:  H2PS20 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALPFALLMALVVLSCKSSCSLGCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFR FPQEEFDGNQFQKAEAISVLYEVIQQTFNLFSTKDSSAAWDERLLDKLYTELYQQLNDLE ACVMQEVLVGETPLKNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN LQERLRMKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggctttgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc tctctgggctgtgatctgcctcagacccacagcctgggtcacaggaggaccatgatgctc ctggcacaaatgaggagaatctctcttttctcctgtctgaaggacagacacgacttcaga tttccccaggaggagtttgatggcaaccagttccagaaggctgaagccatctctgtcctc tatgaggttatccagcagaccttcaacctcttcagcacaaaggactcatctgctgcttgg gatgagaggcttctagacaaactctacactgaactttaccagcagctgaatgacctggaa gcttgtgtgatgcaggaggtgttggtgggagagactcccctgaagaatgaagactccatc ctggctgtgagaaaatacttccaaagaatcactctctacctgacagagaagaagtacagc ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctcttcatcaagaaac ttgcaagaaagattaaggatgaaggaataa

Pongo abelii (Sumatran orangutan): 100434796 Help Entry 100434796         CDS       T01416                                  Definition (RefSeq) interferon alpha-5   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100434796    04151 PI3K-Akt signaling pathway     100434796   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100434796  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100434796  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100434796    04621 NOD-like receptor signaling pathway     100434796    04622 RIG-I-like receptor signaling pathway     100434796    04623 Cytosolic DNA-sensing pathway     100434796    04650 Natural killer cell mediated cytotoxicity     100434796  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100434796   09163 Immune disease    05320 Autoimmune thyroid disease     100434796   09171 Infectious disease: bacterial    05152 Tuberculosis     100434796   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100434796    05161 Hepatitis B     100434796    05160 Hepatitis C     100434796    05171 Coronavirus disease - COVID-19     100434796    05164 Influenza A     100434796    05162 Measles     100434796    05168 Herpes simplex virus 1 infection     100434796    05163 Human cytomegalovirus infection     100434796    05167 Kaposi sarcoma-associated herpesvirus infection     100434796    05169 Epstein-Barr virus infection     100434796    05165 Human papillomavirus infection     100434796  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100434796 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100434796 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CBF APC1_C Motif Other DBs NCBI-GeneID:  100434796 NCBI-ProteinID:  XP_002819793 Ensembl:  ENSPPYG00000019180 UniProt:  H2PS22 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALPFALLMALMVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG FPQEEFDGNQFQKAQAISVLLEMIQQTFNLFSTKDSSGTWDETLLDKFYTELYQQLNDLE ACMMQEVGAEDTPLMNVDSILAVRKYFQRITLYLAEKKYSPCAWEVVRAEIMRSFSLSTN LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgccctttgctttactgatggccctgatggtgctcaactgcaagtcaatctgt tctctcggctgtgatctgcctcagactcacagcctgagtaataggaggactttgatgatc atggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga tttcctcaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctt cttgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctggtacttgg gatgagacacttctagacaaattctacactgaactttaccagcagctgaatgacctggaa gcctgtatgatgcaggaggttggagcggaagacactcctctgatgaatgtggactctatc ctggctgtgagaaaatactttcaaagaatcactctctatctggcagagaagaaatacagc ccttgtgcatgggaggttgttagagcagaaatcatgagatccttctctttatcaacaaac ttgcaagaaagattaaggaggaaggaatga

Pongo abelii (Sumatran orangutan): 100435169 Help Entry 100435169         CDS       T01416                                  Definition (RefSeq) interferon alpha-14   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100435169    04151 PI3K-Akt signaling pathway     100435169   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100435169  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100435169  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100435169    04621 NOD-like receptor signaling pathway     100435169    04622 RIG-I-like receptor signaling pathway     100435169    04623 Cytosolic DNA-sensing pathway     100435169    04650 Natural killer cell mediated cytotoxicity     100435169  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100435169   09163 Immune disease    05320 Autoimmune thyroid disease     100435169   09171 Infectious disease: bacterial    05152 Tuberculosis     100435169   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100435169    05161 Hepatitis B     100435169    05160 Hepatitis C     100435169    05171 Coronavirus disease - COVID-19     100435169    05164 Influenza A     100435169    05162 Measles     100435169    05168 Herpes simplex virus 1 infection     100435169    05163 Human cytomegalovirus infection     100435169    05167 Kaposi sarcoma-associated herpesvirus infection     100435169    05169 Epstein-Barr virus infection     100435169    05165 Human papillomavirus infection     100435169  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100435169 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100435169 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon APC1_C DDHD CoV_NSP2_N Motif Other DBs NCBI-GeneID:  100435169 NCBI-ProteinID:  XP_002819794 Ensembl:  ENSPPYG00000019181 UniProt:  A0A6D2WFG4 H2PS23 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALPFALMMALVVLSCKSSGSLGCNLSQTHSLNSRRTLMLMAQMRRISPFSCLKDRHDFE FPQEEFDGNQFQKAQAISVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYIELFQQMNDLE ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLMEKKYSPCAWEVVRAEIMRSLSFSTN LQKKLRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcattgccctttgctttaatgatggccctggtggtgctcagctgcaagtcaagtggc tctctgggctgtaacctgtctcaaacccacagcctgaatagcaggaggactttgatgctc atggcacaaatgaggagaatctctcctttctcctgcctgaaggacagacatgactttgaa tttccccaggaggagtttgatggcaaccagttccagaaggctcaggccatctctgtcctc catgagatgatccagcagatcttcaacctcttcagcacaaaggactcatctgctgcttgg gatgagaccctcctagacaaattctacattgaacttttccagcaaatgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc ctggctgtgaagaaatacttccaaagaatcactgtttatctgatggagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcgacaaac ttgcaaaaaaaattaaggaggaaggattga

Pongo abelii (Sumatran orangutan): 100437034 Help Entry 100437034         CDS       T01416                                  Definition (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100437034    04151 PI3K-Akt signaling pathway     100437034   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100437034  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100437034  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100437034    04621 NOD-like receptor signaling pathway     100437034    04622 RIG-I-like receptor signaling pathway     100437034    04623 Cytosolic DNA-sensing pathway     100437034    04650 Natural killer cell mediated cytotoxicity     100437034  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100437034   09163 Immune disease    05320 Autoimmune thyroid disease     100437034   09171 Infectious disease: bacterial    05152 Tuberculosis     100437034   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100437034    05161 Hepatitis B     100437034    05160 Hepatitis C     100437034    05171 Coronavirus disease - COVID-19     100437034    05164 Influenza A     100437034    05162 Measles     100437034    05168 Herpes simplex virus 1 infection     100437034    05163 Human cytomegalovirus infection     100437034    05167 Kaposi sarcoma-associated herpesvirus infection     100437034    05169 Epstein-Barr virus infection     100437034    05165 Human papillomavirus infection     100437034  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100437034 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100437034 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  100437034 NCBI-ProteinID:  XP_002819797 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALSFPLLMAMLVLSCKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFNTKDSSAAWEQSLLEKFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLTEKKYSPCAWEVVRAEVMRSFSYSTS LQKRIRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtcctttcctttactgatggccatgctggtgctcagctgcaaatccatctgt tctctgggctgtgatctgcctcagactcacagcctgggtaataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcaacacaaaggactcatctgctgcttgg gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc ctggctgtgaagaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagatccttctcttattcaacaagc ctgcaaaaaagaataaggaggaaggattga

Pongo abelii (Sumatran orangutan): 100438149 Help Entry 100438149         CDS       T01416                                  Definition (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100438149    04151 PI3K-Akt signaling pathway     100438149   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100438149  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100438149  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100438149    04621 NOD-like receptor signaling pathway     100438149    04622 RIG-I-like receptor signaling pathway     100438149    04623 Cytosolic DNA-sensing pathway     100438149    04650 Natural killer cell mediated cytotoxicity     100438149  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100438149   09163 Immune disease    05320 Autoimmune thyroid disease     100438149   09171 Infectious disease: bacterial    05152 Tuberculosis     100438149   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100438149    05161 Hepatitis B     100438149    05160 Hepatitis C     100438149    05171 Coronavirus disease - COVID-19     100438149    05164 Influenza A     100438149    05162 Measles     100438149    05168 Herpes simplex virus 1 infection     100438149    05163 Human cytomegalovirus infection     100438149    05167 Kaposi sarcoma-associated herpesvirus infection     100438149    05169 Epstein-Barr virus infection     100438149    05165 Human papillomavirus infection     100438149  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100438149 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100438149 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  100438149 NCBI-ProteinID:  XP_003777418 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALSFPLLMAMLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFGTKDSSAAWEQSLLEKFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLTEKKYSPCAWEVVRAEVMRSFSYSTS LQKRIRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtcctttcctttactgatggccatgctggtgctcagctacaaatccatctgt tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgattttgga ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctctttggcacaaaggactcatctgctgcttgg gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc ctggctgtgaagaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagatccttctcttattcaacaagc ctgcaaaaaagaataaggaggaaggattga

Pongo abelii (Sumatran orangutan): 100438871 Help Entry 100438871         CDS       T01416                                  Definition (RefSeq) interferon alpha-17-like   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100438871    04151 PI3K-Akt signaling pathway     100438871   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100438871  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100438871  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100438871    04621 NOD-like receptor signaling pathway     100438871    04622 RIG-I-like receptor signaling pathway     100438871    04623 Cytosolic DNA-sensing pathway     100438871    04650 Natural killer cell mediated cytotoxicity     100438871  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100438871   09163 Immune disease    05320 Autoimmune thyroid disease     100438871   09171 Infectious disease: bacterial    05152 Tuberculosis     100438871   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100438871    05161 Hepatitis B     100438871    05160 Hepatitis C     100438871    05171 Coronavirus disease - COVID-19     100438871    05164 Influenza A     100438871    05162 Measles     100438871    05168 Herpes simplex virus 1 infection     100438871    05163 Human cytomegalovirus infection     100438871    05167 Kaposi sarcoma-associated herpesvirus infection     100438871    05169 Epstein-Barr virus infection     100438871    05165 Human papillomavirus infection     100438871  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100438871 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100438871 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon APC1_C Motif Other DBs NCBI-GeneID:  100438871 NCBI-ProteinID:  XP_002819799 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQLQKAQAISVFHEMIQQTFNLFSTKDSSAAWDETLLNKFYIELFQQMNDLE ACVIQEVGVEETPLMNVDSILAVRKYFQRITVYLTEKKYSPCAWEVVRAEIMRSLSFSTN LQKGLRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcttc catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg gatgagaccctcctaaacaaattctacattgaacttttccagcaaatgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgtggactccatc ctggctgtgaggaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac ttgcaaaaaggattaaggaggaaggattga

Pongo abelii (Sumatran orangutan): 100439978 Help Entry 100439978         CDS       T01416                                  Gene name IFNA21 Definition (RefSeq) interferon alpha-21   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100439978 (IFNA21)    04151 PI3K-Akt signaling pathway     100439978 (IFNA21)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100439978 (IFNA21)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100439978 (IFNA21)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100439978 (IFNA21)    04621 NOD-like receptor signaling pathway     100439978 (IFNA21)    04622 RIG-I-like receptor signaling pathway     100439978 (IFNA21)    04623 Cytosolic DNA-sensing pathway     100439978 (IFNA21)    04650 Natural killer cell mediated cytotoxicity     100439978 (IFNA21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100439978 (IFNA21)   09163 Immune disease    05320 Autoimmune thyroid disease     100439978 (IFNA21)   09171 Infectious disease: bacterial    05152 Tuberculosis     100439978 (IFNA21)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100439978 (IFNA21)    05161 Hepatitis B     100439978 (IFNA21)    05160 Hepatitis C     100439978 (IFNA21)    05171 Coronavirus disease - COVID-19     100439978 (IFNA21)    05164 Influenza A     100439978 (IFNA21)    05162 Measles     100439978 (IFNA21)    05168 Herpes simplex virus 1 infection     100439978 (IFNA21)    05163 Human cytomegalovirus infection     100439978 (IFNA21)    05167 Kaposi sarcoma-associated herpesvirus infection     100439978 (IFNA21)    05169 Epstein-Barr virus infection     100439978 (IFNA21)    05165 Human papillomavirus infection     100439978 (IFNA21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100439978 (IFNA21) Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100439978 (IFNA21) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100439978 NCBI-ProteinID:  XP_002819800 UniProt:  A0A2J8XIC9 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALPFSLLMAVVVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFNTKDSSAAWEQSLLEKFSTELNQQLNDLE ACMIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKT FQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgcccttttctttactgatggccgtggtggtgctcagctacaaatccatctgt tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaagacagacatgatttcgga ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcaacacaaaagactcatctgctgcttgg gaacagagcctcctagaaaaattttccactgaacttaaccagcaactgaacgacctggaa gcctgtatgatacaggaggttggggtggaagagactcccctgatgaatgtggactccatc ctggctgtgaagaaatacttccaaagaatcactctttatctcacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaaaaacc tttcaagaaagattaaggaggaaggaatga

Pongo abelii (Sumatran orangutan): 100441074 Help Entry 100441074         CDS       T01416                                  Gene name IFNB1 Definition (RefSeq) interferon beta   KO K05415   interferon beta Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04380   Osteoclast differentiation pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon04668   TNF signaling pathway pon05135   Yersinia infection pon05142   Chagas disease pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100441074 (IFNB1)    04668 TNF signaling pathway     100441074 (IFNB1)    04151 PI3K-Akt signaling pathway     100441074 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100441074 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100441074 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100441074 (IFNB1)    04621 NOD-like receptor signaling pathway     100441074 (IFNB1)    04622 RIG-I-like receptor signaling pathway     100441074 (IFNB1)    04623 Cytosolic DNA-sensing pathway     100441074 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     100441074 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100441074 (IFNB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     100441074 (IFNB1)    05152 Tuberculosis     100441074 (IFNB1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100441074 (IFNB1)    05161 Hepatitis B     100441074 (IFNB1)    05160 Hepatitis C     100441074 (IFNB1)    05171 Coronavirus disease - COVID-19     100441074 (IFNB1)    05164 Influenza A     100441074 (IFNB1)    05162 Measles     100441074 (IFNB1)    05168 Herpes simplex virus 1 infection     100441074 (IFNB1)    05163 Human cytomegalovirus infection     100441074 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     100441074 (IFNB1)    05169 Epstein-Barr virus infection     100441074 (IFNB1)    05165 Human papillomavirus infection     100441074 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     100441074 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100441074 (IFNB1) Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100441074 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Forkhead Motif Other DBs NCBI-GeneID:  100441074 NCBI-ProteinID:  XP_002819803 Ensembl:  ENSPPYG00000019185 UniProt:  A0A6D2XNH4 H2PS27 LinkDB All DBs Position 9 AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGRFEYCLKDRMNFD IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK TVLEEKLEKEYFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINR LTGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag ctcctgtggcaattgaatgggaggtttgaatattgcctcaaggacaggatgaactttgac atccctgaggagattaagcagctgcagcagttccagaaggaggacgcggcattgaccatc tacgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg aatgagaccattgttgagaacctccttgctaatgtctatcatcagataaaccatctgaag acagttctggaagaaaaactggagaaagaatatttcaccaggggaaaattcatgagcagt ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagt cactgtgcctggaccatagtcagagtggaaatcctcaggaactttttcttcattaacaga cttacaggttacctccgaaactga

Pongo abelii (Sumatran orangutan): 100442480 Help Entry 100442480         CDS       T01416                                  Gene name CSF3 Definition (RefSeq) granulocyte colony-stimulating factor isoform X2   KO K05423   granulocyte colony-stimulating factor Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04640   Hematopoietic cell lineage pon04657   IL-17 signaling pathway pon05144   Malaria pon05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100442480 (CSF3)    04151 PI3K-Akt signaling pathway     100442480 (CSF3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100442480 (CSF3)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100442480 (CSF3)    04657 IL-17 signaling pathway     100442480 (CSF3)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100442480 (CSF3)   09174 Infectious disease: parasitic    05144 Malaria     100442480 (CSF3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100442480 (CSF3) Cytokines and growth factors [BR:pon04052]  Cytokines   CSF and other factors    100442480 (CSF3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GCSF IL11 NAGLU IL6 Img2 Motif Other DBs NCBI-GeneID:  100442480 NCBI-ProteinID:  XP_002827665 Ensembl:  ENSPPYG00000008471 UniProt:  A0A2J8WA76 LinkDB All DBs Position 17 AA seq 204 aa AA seqDB search MAGPAAQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA LQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLTGCLSQLHSGLFLYQGLLQ ALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGG ILVASHLQSFLELAYRVLRHLAQP NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggctggacctgccgcccagagccccatgaagctgatggccctgcagctgctgctgtgg cacagcgcactctggacagtgcaggaagccacccccctgggccctgccagctccctgccc cagagcttcctgctcaagtgcttagagcaagtgaggaagatccagggcgatggcgcggca ctccaggagaagctgtgtgccacctacaagctgtgccaccccgaggagctggtgctgctc ggacactctctgggcatcccctgggctcccctgagcagctgccccagccaggccctgcag ctgacaggctgcttgagccaactccatagcggcctcttcctctaccaggggctcctgcag gccctggaagggatctcccctgagttgggccccaccttggacacactgcagctggacgtc gccgactttgccaccaccatctggcagcagatggaagaactgggaatggcccctgccctg cagcccacccagggtgccatgccagcctttgcctctgccttccagcgccgggccggaggc atcctggttgcctcccatctgcagagcttcctggagctggcgtaccgcgttctacgccac cttgcccagccctga

Pongo abelii (Sumatran orangutan): 100443523 Help Entry 100443523         CDS       T01416                                  Definition (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100443523    04151 PI3K-Akt signaling pathway     100443523   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100443523  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100443523  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100443523    04621 NOD-like receptor signaling pathway     100443523    04622 RIG-I-like receptor signaling pathway     100443523    04623 Cytosolic DNA-sensing pathway     100443523    04650 Natural killer cell mediated cytotoxicity     100443523  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100443523   09163 Immune disease    05320 Autoimmune thyroid disease     100443523   09171 Infectious disease: bacterial    05152 Tuberculosis     100443523   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100443523    05161 Hepatitis B     100443523    05160 Hepatitis C     100443523    05171 Coronavirus disease - COVID-19     100443523    05164 Influenza A     100443523    05162 Measles     100443523    05168 Herpes simplex virus 1 infection     100443523    05163 Human cytomegalovirus infection     100443523    05167 Kaposi sarcoma-associated herpesvirus infection     100443523    05169 Epstein-Barr virus infection     100443523    05165 Human papillomavirus infection     100443523  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100443523 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100443523 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100443523 NCBI-ProteinID:  XP_024108288 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MSLSFSLLMAMVVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFGTKDSSAAWEQSLLERFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSIMAVRKYFQRITVYLTEKKYSPCAWEVVRAEIMRSFSYATR LQKRIRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgtccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgt tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcggcacaaaggactcatctgctgcttgg gaacagagcctcctagaaagattttccactgaactttaccagcaactgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc atggctgtgaggaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctcttatgcaacaagg ctgcaaaaaagaataaggaggaaggattga

Pongo abelii (Sumatran orangutan): 100445711 Help Entry 100445711         CDS       T01416                                  Definition (RefSeq) interferon alpha-10-like   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100445711    04151 PI3K-Akt signaling pathway     100445711   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100445711  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100445711  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100445711    04621 NOD-like receptor signaling pathway     100445711    04622 RIG-I-like receptor signaling pathway     100445711    04623 Cytosolic DNA-sensing pathway     100445711    04650 Natural killer cell mediated cytotoxicity     100445711  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100445711   09163 Immune disease    05320 Autoimmune thyroid disease     100445711   09171 Infectious disease: bacterial    05152 Tuberculosis     100445711   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100445711    05161 Hepatitis B     100445711    05160 Hepatitis C     100445711    05171 Coronavirus disease - COVID-19     100445711    05164 Influenza A     100445711    05162 Measles     100445711    05168 Herpes simplex virus 1 infection     100445711    05163 Human cytomegalovirus infection     100445711    05167 Kaposi sarcoma-associated herpesvirus infection     100445711    05169 Epstein-Barr virus infection     100445711    05165 Human papillomavirus infection     100445711  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100445711 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100445711 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100445711 NCBI-ProteinID:  XP_003780011 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFGTKDSSAAWEQSLLEKFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVIRAEIMRSFSFSTN LEKRLRKKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcggcacaaaggactcatctgctgcttgg gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc ctggctgtgaggaaatacttccaaagaatcaccctttatctgatggagaagaaatacagc ccttgtgcctgggaggttatcagagcagaaatcatgagatccttctctttttcaacaaac ttggaaaaaagattaaggaagaaggattga

Pongo abelii (Sumatran orangutan): 100446663 Help Entry 100446663         CDS       T01416                                  Definition (RefSeq) chorionic somatomammotropin hormone 2 isoform X2   KO K05438   growth hormone Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04080   Neuroactive ligand-receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100446663    04151 PI3K-Akt signaling pathway     100446663   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100446663    04060 Cytokine-cytokine receptor interaction     100446663  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     100446663  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100446663 Cytokines and growth factors [BR:pon04052]  Cytokines   CSF and other factors    100446663 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_1 Motif Other DBs NCBI-GeneID:  100446663 NCBI-ProteinID:  XP_002827746 Ensembl:  ENSPPYG00000008535 UniProt:  H2NUF4 LinkDB All DBs Position 17 AA seq 217 aa AA seqDB search MAAGSQTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEDA YISKDQKYSFLHGSQTSFCFSDSIPTPSNMEETQQKSNSELLRLSLLLIESWLEPVRLLR SIFTNNLVYDTSDSNDYHLLKDLEEGIQTLMGRLEDGSPRTGQILKQTYSKFDTNSHNHD ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggctgcaggctcccagacgtccctgctcctggcttttgccctgctctgtctgccctgg cttcaagaggctggtgccgtccaaaccgttcccttatccaggctttttgaccatgctatg ctccaagcccatcgcgcccaccagctggccattgacacctaccaggagtttgaagacgcc tatatctcaaaggaccagaagtattcattcctgcatggctcccagacctccttctgcttc tcagactctattccgacaccctccaacatggaggaaacgcagcagaaatcgaactcagag ctgctccgcctctccctgctgctcatcgagtcgtggctagagcccgtgcggctcctcagg agtatcttcaccaacaacctggtgtatgacacctcggacagcaatgactatcacctccta aaggacctagaggaaggaatccaaacgctgatggggaggctggaagacggcagcccccgg actgggcagatcctcaagcagacctacagcaagtttgacacaaactcgcacaaccatgac gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

Pongo abelii (Sumatran orangutan): 100447057 Help Entry 100447057         CDS       T01416                                  Gene name IL3 Definition (RefSeq) interleukin-3   KO K04736   interleukin 3 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04210   Apoptosis pon04630   JAK-STAT signaling pathway pon04640   Hematopoietic cell lineage pon04664   Fc epsilon RI signaling pathway pon05200   Pathways in cancer pon05202   Transcriptional misregulation in cancer pon05221   Acute myeloid leukemia pon05310   Asthma Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100447057 (IL3)    04151 PI3K-Akt signaling pathway     100447057 (IL3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100447057 (IL3)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100447057 (IL3)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100447057 (IL3)    04664 Fc epsilon RI signaling pathway     100447057 (IL3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100447057 (IL3)    05202 Transcriptional misregulation in cancer     100447057 (IL3)   09162 Cancer: specific types    05221 Acute myeloid leukemia     100447057 (IL3)   09163 Immune disease    05310 Asthma     100447057 (IL3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100447057 (IL3)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100447057 (IL3) Cytokines and growth factors [BR:pon04052]  Cytokines   Interleukins    100447057 (IL3) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Cytokines    100447057 (IL3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL3 Ldl_recept_b Motif Other DBs NCBI-GeneID:  100447057 NCBI-ProteinID:  XP_002815901 Ensembl:  ENSPPYG00000015753 UniProt:  A0A663D7Y1 H2PGH1 LinkDB All DBs Position 5 AA seq 152 aa AA seqDB search MSCLPVLLLLQLLVSPGLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN GEDQDILMENNLRRPNLEAFNKAVKSLQNASAIESILKNLPPCLPMATAAPMRHPIRIKD GDWNEFRRKLTFYLKTLENAQAQQMTLSVEIS NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgagctgcctgcccgtcctgctcctgctccaactcctggtcagccccggactccaagct cccatgacccagacaacttccttgaagacaagctgggttaactgctctaacatgattgat gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat ggggaagaccaagacattctgatggaaaataacctccgaaggccaaacctggaggcattc aacaaggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc ccgccatgcctgcccatggccacggccgcacccatgcgacatccaatccgtatcaaggac ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgca caggctcaacagatgactttgagcgtcgagatctcttga

Pongo abelii (Sumatran orangutan): 100447454 Help Entry 100447454         CDS       T01416                                  Gene name IL7 Definition (RefSeq) interleukin-7 isoform X1   KO K05431   interleukin 7 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04640   Hematopoietic cell lineage pon05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100447454 (IL7)    04151 PI3K-Akt signaling pathway     100447454 (IL7)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100447454 (IL7)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100447454 (IL7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100447454 (IL7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100447454 (IL7)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100447454 (IL7) Cytokines and growth factors [BR:pon04052]  Cytokines   Interleukins    100447454 (IL7) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Cytokines    100447454 (IL7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL7 Motif Other DBs NCBI-GeneID:  100447454 NCBI-ProteinID:  XP_002819245 Ensembl:  ENSPPYG00000018691 UniProt:  A0A6D2XIV8 A0A2J8V9Y2 LinkDB All DBs Position 8 AA seq 177 aa AA seqDB search MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCL NNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQ VKGRKPSALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH NT seq 534 nt NT seq  +upstreamnt  +downstreamnt atgttccatgtttcttttaggtatatctttggacttcctcccctgatccttgttctgttg ccagtagcatcatctgattgtgatattgaaggtaaagatggcaaacaatatgagagtgtt ctaatggtcagcatcgatcaattattggacagcatgaaagaaattggtagcaattgcctg aataatgaatttaacttttttaaaagacatatctgtgatgctaataaggaaggtatgttt ttattccgtgctgctcgcaagttgaggcaatttcttaaaatgaatagcactggtgatttt gatctccacttattaaaagtttcagaaggcacaacaatactgttgaactgcactggccag gttaaaggaagaaaaccatctgccctaggtgaagcccaaccaacaaagagtttggaagaa aataaatctttaaaggaacagaaaaaactgaatgacttgtgtttcctaaagagactacta caagagataaaaacttgttggaataaaattttgatgggcactaaagaacactga

Pongo abelii (Sumatran orangutan): 100447767 Help Entry 100447767         CDS       T01416                                  Definition (RefSeq) growth hormone variant isoform X1   KO K05438   growth hormone Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04080   Neuroactive ligand-receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100447767    04151 PI3K-Akt signaling pathway     100447767   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100447767    04060 Cytokine-cytokine receptor interaction     100447767  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     100447767  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100447767 Cytokines and growth factors [BR:pon04052]  Cytokines   CSF and other factors    100447767 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_1 HTH_5 Motif Other DBs NCBI-GeneID:  100447767 NCBI-ProteinID:  XP_002827750 UniProt:  A0A1B1R0V1 A0A0M6L0G5 LinkDB All DBs Position 17 AA seq 217 aa AA seqDB search MAAGSQTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKMQQKSNLELLRISVLLIQSWLEPVWFLR SVFANSLVYGASDSNVYHHLKDLEEGIQTLMWRLEDGSPQTGQIFKQTYSKFDTKSHNDD ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVKGSCGF NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggctgcaggctcccagacgtccctgctcctggcttttggcctgctctgcctgccctgg cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaatgctatg ctccgcgcccatcgcctgcaccagctggcatttgacacctaccaggagtttgaagaagcc tatatcctgaaggagcagaagtattcattcctgcagaacccccagacctccctctgcttc tcagagtctattccgacaccttccaacagggtgaaaatgcagcagaaatccaacctagag ctgctccgcatctctgtgctgctcatccagtcatggctggagcccgtgtggttcctcagg agtgtcttcgccaacagcctggtgtatggcgcctcagacagcaatgtctatcaccaccta aaggacctagaggaaggcatccaaacgctgatgtggaggctggaagatggcagcccccag actgggcagatcttcaagcagacctacagcaagtttgacacaaaatcgcacaacgatgac gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag acattcctgcgcatcgtgcagtgccgctctgtgaaaggcagctgtggcttctag

Pongo abelii (Sumatran orangutan): 100448170 Help Entry 100448170         CDS       T01416                                  Gene name OSM Definition (RefSeq) oncostatin-M isoform X1   KO K05418   oncostatin M Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100448170 (OSM)    04151 PI3K-Akt signaling pathway     100448170 (OSM)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100448170 (OSM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100448170 (OSM) Cytokines and growth factors [BR:pon04052]  Cytokines   CSF and other factors    100448170 (OSM) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LIF_OSM IL23 Motif Other DBs NCBI-GeneID:  100448170 NCBI-ProteinID:  XP_002831046 Ensembl:  ENSPPYG00000011704 UniProt:  H2P411 A0A663D964 LinkDB All DBs Position 22 AA seq 252 aa AA seqDB search MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYHVLLGQLQKQTDLMQDTSRLLDPYI RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA QDLERSGLNIEDLEKLQMARPNVLGLRNNIYCMAQLLDNSDTAEPTKAGWGASQPPTPTP ASDAFQRKLEGCRFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK GKRLMPRGQLPR NT seq 759 nt NT seq  +upstreamnt  +downstreamnt atgggggtactgctcacacagaggacgctgctcagtctggtccttgcactcctgtttcca agcatggcgagcatggcggctataggcagctgctcgaaagagtaccacgtgctccttggc cagctccagaagcagacagatctcatgcaggacaccagcagactcctggacccctatata cgtatccaaggcctggatgttcctaaactgagagagcactgcagggagcgccccggggcc ttccccagcgaggagaccctgagggggctgggcaggcggggcttcctgcagaccctcaat gccacactgggctgcgtcctgcacagactggccgacttagagcagcgcctccccaaggcc caggatttggagaggtctgggctgaacatcgaggacttggagaagctgcagatggcgagg ccgaacgtcctcgggctcaggaacaacatctactgcatggcccagctgctggacaactca gacacggctgagcccacgaaggctggctggggggcctctcagccgcccacccccacccct gcctcggatgcttttcagcgcaagctggagggctgcagattcctgcgtggctaccatcgc ttcatgcactcagtggggcgggtcttcagcaagtggggggagagcccaaaccggagccgg agacacagcccccaccaggccctgaggaagggggtgcgcaggaccagaccctccaggaaa ggcaagagactcatgcccaggggacagcttccccggtag

Pongo abelii (Sumatran orangutan): 100448861 Help Entry 100448861         CDS       T01416                                  Gene name GH1 Definition (RefSeq) somatotropin isoform X2   KO K05438   growth hormone Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04080   Neuroactive ligand-receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100448861 (GH1)    04151 PI3K-Akt signaling pathway     100448861 (GH1)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100448861 (GH1)    04060 Cytokine-cytokine receptor interaction     100448861 (GH1)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     100448861 (GH1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100448861 (GH1) Cytokines and growth factors [BR:pon04052]  Cytokines   CSF and other factors    100448861 (GH1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_1 Motif Other DBs NCBI-GeneID:  100448861 NCBI-ProteinID:  XP_002827754 UniProt:  A0A0M6L0K8 A0A663DDR1 LinkDB All DBs Position 17 AA seq 217 aa AA seqDB search MAAGSRTSLLLAFALLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggctgcaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg ctccgcgcccatcgcctgcaccagctggcctttgacacctaccaggagtttgaagaagcc tatatcccaaaggaacagaagtattcattcctgcagaacccccagacctccctctgcttc tcagagtctattccgacaccctccaacagggaggaaacgcaacagaaatccaacctagag ctgctccgcatctctctgctgctcatccagtcgtggctggagcccgtgcagttcctcagg agtgtctttgccaacagcctggtttatggcgcctcggacagcaacgtctatgacctccta aaggacctagaggaaggcatccaaacgctaatggggaggctggaagatggcagcccccgg actgggcagatcttcaagcagacctacagcaagtttgacacaaattcacacaacgatgac gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

Pongo abelii (Sumatran orangutan): 100450466 Help Entry 100450466         CDS       T01416                                  Gene name PRL Definition (RefSeq) prolactin   KO K05439   prolactin Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04080   Neuroactive ligand-receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04917   Prolactin signaling pathway Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100450466 (PRL)    04151 PI3K-Akt signaling pathway     100450466 (PRL)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100450466 (PRL)    04060 Cytokine-cytokine receptor interaction     100450466 (PRL)  09150 Organismal Systems   09152 Endocrine system    04917 Prolactin signaling pathway     100450466 (PRL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100450466 (PRL) Cytokines and growth factors [BR:pon04052]  Cytokines   CSF and other factors    100450466 (PRL) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_1 Motif Other DBs NCBI-GeneID:  100450466 NCBI-ProteinID:  XP_002816520 Ensembl:  ENSPPYG00000016273 UniProt:  H2PI19 A0A6D2X691 LinkDB All DBs Position 6 AA seq 227 aa AA seqDB search MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQINQKDFLSLIVSILRSWN EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG LSSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC NT seq 684 nt NT seq  +upstreamnt  +downstreamnt atgaacatcaaaggatcgccatggaaagggtccctcctgctgctgctggtgtcaaacctg ctcctgtgccagagcgtggcccccttgcccatctgtcccggcggggctgccagatgccag gtgacccttcgagacctgtttgaccgcgcagtcgtcctgtcccactacatccataacctc tcctcagaaatgttcagcgaatttgataaacggtatacccatggccgggggttcatcacc aaggccatcaacagctgccacacttcttcccttgccacccccgaagacaaggagcaagcc caacagatcaatcaaaaagactttctgagcctgatagtcagcatattgcgatcctggaat gagcctctgtatcatctagtcacggaagtacgtggtatgcaagaagccccagaggctatc ctatccaaagccgtagagattgaggagcaaaccaaacggcttctagagggcatggagctg atagtcagccaggttcatcctgaaaccaaagaaaatgagatctaccctgtctggtcggga ctttcatccctgcagatggctgatgaagagtctcgcctttctgcttattataacctgctc cactgcctacgcagggattcacataaaatcgacaattatctcaagctcctgaagtgccga atcatccacaacaacaactgctaa

Pongo abelii (Sumatran orangutan): 100451705 Help Entry 100451705         CDS       T01416                                  Gene name IL4 Definition (RefSeq) interleukin-4 isoform X1   KO K05430   interleukin 4 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04640   Hematopoietic cell lineage pon04657   IL-17 signaling pathway pon04658   Th1 and Th2 cell differentiation pon04659   Th17 cell differentiation pon04660   T cell receptor signaling pathway pon04664   Fc epsilon RI signaling pathway pon04672   Intestinal immune network for IgA production pon05140   Leishmaniasis pon05200   Pathways in cancer pon05310   Asthma pon05320   Autoimmune thyroid disease pon05321   Inflammatory bowel disease pon05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100451705 (IL4)    04151 PI3K-Akt signaling pathway     100451705 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100451705 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100451705 (IL4)    04660 T cell receptor signaling pathway     100451705 (IL4)    04658 Th1 and Th2 cell differentiation     100451705 (IL4)    04659 Th17 cell differentiation     100451705 (IL4)    04657 IL-17 signaling pathway     100451705 (IL4)    04664 Fc epsilon RI signaling pathway     100451705 (IL4)    04672 Intestinal immune network for IgA production     100451705 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100451705 (IL4)   09163 Immune disease    05310 Asthma     100451705 (IL4)    05320 Autoimmune thyroid disease     100451705 (IL4)    05321 Inflammatory bowel disease     100451705 (IL4)    05330 Allograft rejection     100451705 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100451705 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100451705 (IL4)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100451705 (IL4) Cytokines and growth factors [BR:pon04052]  Cytokines   Interleukins    100451705 (IL4) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Cytokines    100451705 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Mannosyl_trans3 Motif Other DBs NCBI-GeneID:  100451705 NCBI-ProteinID:  XP_002815914 Ensembl:  ENSPPYG00000015766 UniProt:  A0A663D5P8 H2PGI4 LinkDB All DBs Position 5 AA seq 153 aa AA seqDB search MGLTSQLLPPLFFLLACAGNFVHGHKCDIALQEIIKTLNSLTEQKTLCTELTVTDIFAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL NSCPVKEANQSTLEDFLERLKTIMREKYSKCSS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac tttgtccatggacacaagtgcgatatcgccttacaagagatcatcaaaactttgaacagc ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac agccaccatgagaaggacactcgctgtctgggtgcgactgcacagcagttccacagacac aagcagctcatccgattcctgaaacggctcgacaggaacctctggggcctggcgggtttg aattcctgtcctgtgaaggaagccaaccagagtacgttggaagacttcttggaaaggcta aagacgatcatgagagaaaaatattcaaagtgttcgagctga

Pongo abelii (Sumatran orangutan): 100453941 Help Entry 100453941         CDS       T01416                                  Gene name IL6 Definition (RefSeq) interleukin-6 isoform X2   KO K05405   interleukin 6 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon01521   EGFR tyrosine kinase inhibitor resistance pon01523   Antifolate resistance pon04060   Cytokine-cytokine receptor interaction pon04061   Viral protein interaction with cytokine and cytokine receptor pon04066   HIF-1 signaling pathway pon04068   FoxO signaling pathway pon04151   PI3K-Akt signaling pathway pon04218   Cellular senescence pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04625   C-type lectin receptor signaling pathway pon04630   JAK-STAT signaling pathway pon04640   Hematopoietic cell lineage pon04657   IL-17 signaling pathway pon04659   Th17 cell differentiation pon04668   TNF signaling pathway pon04672   Intestinal immune network for IgA production pon04931   Insulin resistance pon04932   Non-alcoholic fatty liver disease pon04933   AGE-RAGE signaling pathway in diabetic complications pon05010   Alzheimer disease pon05020   Prion disease pon05022   Pathways of neurodegeneration - multiple diseases pon05132   Salmonella infection pon05133   Pertussis pon05134   Legionellosis pon05135   Yersinia infection pon05142   Chagas disease pon05143   African trypanosomiasis pon05144   Malaria pon05146   Amoebiasis pon05152   Tuberculosis pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05166   Human T-cell leukemia virus 1 infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05202   Transcriptional misregulation in cancer pon05321   Inflammatory bowel disease pon05323   Rheumatoid arthritis pon05332   Graft-versus-host disease pon05410   Hypertrophic cardiomyopathy Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100453941 (IL6)    04668 TNF signaling pathway     100453941 (IL6)    04066 HIF-1 signaling pathway     100453941 (IL6)    04068 FoxO signaling pathway     100453941 (IL6)    04151 PI3K-Akt signaling pathway     100453941 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100453941 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     100453941 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     100453941 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100453941 (IL6)    04620 Toll-like receptor signaling pathway     100453941 (IL6)    04621 NOD-like receptor signaling pathway     100453941 (IL6)    04623 Cytosolic DNA-sensing pathway     100453941 (IL6)    04625 C-type lectin receptor signaling pathway     100453941 (IL6)    04659 Th17 cell differentiation     100453941 (IL6)    04657 IL-17 signaling pathway     100453941 (IL6)    04672 Intestinal immune network for IgA production     100453941 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100453941 (IL6)    05202 Transcriptional misregulation in cancer     100453941 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     100453941 (IL6)    05321 Inflammatory bowel disease     100453941 (IL6)    05332 Graft-versus-host disease     100453941 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     100453941 (IL6)    05020 Prion disease     100453941 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     100453941 (IL6)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     100453941 (IL6)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100453941 (IL6)    04931 Insulin resistance     100453941 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     100453941 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     100453941 (IL6)    05135 Yersinia infection     100453941 (IL6)    05133 Pertussis     100453941 (IL6)    05134 Legionellosis     100453941 (IL6)    05152 Tuberculosis     100453941 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100453941 (IL6)    05161 Hepatitis B     100453941 (IL6)    05171 Coronavirus disease - COVID-19     100453941 (IL6)    05164 Influenza A     100453941 (IL6)    05162 Measles     100453941 (IL6)    05168 Herpes simplex virus 1 infection     100453941 (IL6)    05163 Human cytomegalovirus infection     100453941 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     100453941 (IL6)    05169 Epstein-Barr virus infection     100453941 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     100453941 (IL6)    05144 Malaria     100453941 (IL6)    05142 Chagas disease     100453941 (IL6)    05143 African trypanosomiasis     100453941 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100453941 (IL6)    01523 Antifolate resistance     100453941 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100453941 (IL6) Cytokines and growth factors [BR:pon04052]  Cytokines   Interleukins    100453941 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL11 IL23 Phage_int_SAM_1 GCSF Motif Other DBs NCBI-GeneID:  100453941 NCBI-ProteinID:  XP_002818205 Ensembl:  ENSPPYG00000017740 UniProt:  A0A6D2YB13 A0A2J8VE68 LinkDB All DBs Position 7 AA seq 212 aa AA seqDB search MNSVSTSAFGPVAFSLGLLLVLPAALPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgaactccgtctccacaagcgccttcggtccagttgccttctccctggggctgctcctg gtgttgcctgctgccttacctgccccagtaccaccaggagaagattccaaagatgtagcc gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc ctcgacggcatctcagccctgagaaaggagacttgtaacaagagtaacatgtgtgaaagc agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg gagtttgaggtatacctagagtacctccagaacaggtttgagagcagtgaggaacaagcc agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat ctagatgcaataactacccctgacccaaccacgaatgccagcctgctgacgaagctgcag gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag ttcctgcagtccagcctgagggctcttcggcaaatgtag

Pongo abelii (Sumatran orangutan): 100455248 Help Entry 100455248         CDS       T01416                                  Gene name IL2 Definition (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04061   Viral protein interaction with cytokine and cytokine receptor pon04151   PI3K-Akt signaling pathway pon04625   C-type lectin receptor signaling pathway pon04630   JAK-STAT signaling pathway pon04658   Th1 and Th2 cell differentiation pon04659   Th17 cell differentiation pon04660   T cell receptor signaling pathway pon04672   Intestinal immune network for IgA production pon04940   Type I diabetes mellitus pon05135   Yersinia infection pon05142   Chagas disease pon05162   Measles pon05166   Human T-cell leukemia virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease pon05321   Inflammatory bowel disease pon05330   Allograft rejection pon05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100455248 (IL2)    04151 PI3K-Akt signaling pathway     100455248 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100455248 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     100455248 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100455248 (IL2)    04660 T cell receptor signaling pathway     100455248 (IL2)    04658 Th1 and Th2 cell differentiation     100455248 (IL2)    04659 Th17 cell differentiation     100455248 (IL2)    04672 Intestinal immune network for IgA production     100455248 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100455248 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     100455248 (IL2)    05321 Inflammatory bowel disease     100455248 (IL2)    05330 Allograft rejection     100455248 (IL2)    05332 Graft-versus-host disease     100455248 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100455248 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     100455248 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100455248 (IL2)    05171 Coronavirus disease - COVID-19     100455248 (IL2)    05162 Measles     100455248 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     100455248 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100455248 (IL2)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100455248 (IL2) Cytokines and growth factors [BR:pon04052]  Cytokines   Interleukins    100455248 (IL2) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Cytokines    100455248 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Plasmid_RAQPRD Motif Other DBs NCBI-GeneID:  100455248 NCBI-ProteinID:  XP_002815161 Ensembl:  ENSPPYG00000015043 UniProt:  H2PE89 A0A6D2XRS9 LinkDB All DBs Position 4 AA seq 153 aa AA seqDB search MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta agacccagggacttaatcagcaatatcaatgtaatagttctggaactaaagggatctgaa acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga tggattaccttttgtcaaagcatcatctcaacactgacttga

Pongo abelii (Sumatran orangutan): 100459543 Help Entry 100459543         CDS       T01416                                  Definition (RefSeq) interferon alpha-10   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100459543    04151 PI3K-Akt signaling pathway     100459543   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100459543  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100459543  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100459543    04621 NOD-like receptor signaling pathway     100459543    04622 RIG-I-like receptor signaling pathway     100459543    04623 Cytosolic DNA-sensing pathway     100459543    04650 Natural killer cell mediated cytotoxicity     100459543  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100459543   09163 Immune disease    05320 Autoimmune thyroid disease     100459543   09171 Infectious disease: bacterial    05152 Tuberculosis     100459543   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100459543    05161 Hepatitis B     100459543    05160 Hepatitis C     100459543    05171 Coronavirus disease - COVID-19     100459543    05164 Influenza A     100459543    05162 Measles     100459543    05168 Herpes simplex virus 1 infection     100459543    05163 Human cytomegalovirus infection     100459543    05167 Kaposi sarcoma-associated herpesvirus infection     100459543    05169 Epstein-Barr virus infection     100459543    05165 Human papillomavirus infection     100459543  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100459543 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    100459543 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100459543 NCBI-ProteinID:  XP_002834152 UniProt:  A0A2J8XIC1 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFE FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFGTKDSSAAWEQSLLEKFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLTEKKYSPCAWEVVRAEIMRSFSFSTN LQKRLRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt tctctgggctgtgatctgcctcagacccacagcctgggtaatagaagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgaa tttccccaggaggaatttgatggcaaccagttgcagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcggcacaaaggactcatctgctgcttgg gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc ctggctgtgaagaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac ttgcaaaaaagattaaggaggaaggattga

Pongo abelii (Sumatran orangutan): 100459890 Help Entry 100459890         CDS       T01416                                  Gene name EPO Definition (RefSeq) erythropoietin isoform X1   KO K05437   erythropoietin Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04066   HIF-1 signaling pathway pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04640   Hematopoietic cell lineage pon05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100459890 (EPO)    04066 HIF-1 signaling pathway     100459890 (EPO)    04151 PI3K-Akt signaling pathway     100459890 (EPO)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100459890 (EPO)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100459890 (EPO)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100459890 (EPO)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     100459890 (EPO) Cytokines and growth factors [BR:pon04052]  Cytokines   CSF and other factors    100459890 (EPO) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EPO_TPO Motif Other DBs NCBI-GeneID:  100459890 NCBI-ProteinID:  XP_024105759 LinkDB All DBs Position 7 AA seq 193 aa AA seqDB search MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENVTTGCAEHC SLSENITVPDTKVNFYAWKRMEVGQQALEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL HVDKAVSGLRSLTTLLRALGAQKEANSPPDAALAAPLRTITADTFRKFFRVYSNFLRGKL KLYTEEACRTGDR NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgggggtgcacgaatgtcctgcctggctgtggcttctcctatccctgctgtcgctccct ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag aggtacctcttggaggccaaggaggccgagaatgtcacgacgggctgtgccgaacactgc agcttgagtgagaatatcaccgtcccagacaccaaagttaacttctatgcctggaagagg atggaggtcgggcagcaggccttagaagtctggcagggcctggccctgctctcggaagct gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg cacgtggataaagctgtcagtggccttcgcagcctcaccactctgcttcgggcgctggga gcccagaaggaagccaactcccctccagatgcggccttggctgctccactccgaacaatc actgctgacactttccgcaaattcttccgagtctactccaatttcctccggggaaagctg aagctgtacacagaggaggcctgcaggacaggggacagatga

Pongo abelii (Sumatran orangutan): 103892869 Help Entry 103892869         CDS       T01416                                  Definition (RefSeq) chorionic somatomammotropin hormone 2-like isoform X1   KO K05438   growth hormone Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04080   Neuroactive ligand-receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103892869    04151 PI3K-Akt signaling pathway     103892869   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     103892869    04060 Cytokine-cytokine receptor interaction     103892869  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     103892869  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     103892869 Cytokines and growth factors [BR:pon04052]  Cytokines   CSF and other factors    103892869 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_1 Calcyon Motif Other DBs NCBI-GeneID:  103892869 NCBI-ProteinID:  XP_024090235 LinkDB All DBs Position 17 AA seq 193 aa AA seqDB search MAAGSQTSLLLAFALLCLPWLQEAGAVQTVPFSRPLDHAMLQAHCAHQLAIDTYQEFEEA YIPKDQKYSFLHDSQTSSCFSDSIPTPSNMEETQQKSNSELLHISLLLIESWLEPVWFLR NIFTNNLVFDTSDSDDYHLLKDLEKGIQTLIGRLEDGSPRTGQIFKQTYSKFDTNSHNHD ALLKNYGLLHCFR NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgcaggctcccagacgtccctgctcctggcttttgccctgctctgcctgccctgg cttcaagaggctggtgccgtccaaaccgttcccttttccaggcctcttgaccatgctatg ctccaagcccattgcgcgcaccagctggccattgacacctaccaggagtttgaagaagcc tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctcctcctgcttc tcagactctattccgacaccctccaacatggaggaaacgcagcagaaatcgaactcagag ctgctccacatctccctgctgctcatcgagtcgtggctggagcccgtgtggttcctcagg aatatcttcaccaacaacctggtgtttgacacctcggacagcgatgactatcacctccta aaggacttagagaaaggcatccaaacgctgattgggaggctggaagacggcagtccccgg actgggcagatcttcaaacagacctacagcaagtttgacacaaactcacacaaccatgac gctctgctcaagaactacgggctgctccactgcttcaggtag

Pongo abelii (Sumatran orangutan): 112134962 Help Entry 112134962         CDS       T01416                                  Definition (RefSeq) interferon alpha-10-like   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112134962    04151 PI3K-Akt signaling pathway     112134962   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112134962  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112134962  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112134962    04621 NOD-like receptor signaling pathway     112134962    04622 RIG-I-like receptor signaling pathway     112134962    04623 Cytosolic DNA-sensing pathway     112134962    04650 Natural killer cell mediated cytotoxicity     112134962  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112134962   09163 Immune disease    05320 Autoimmune thyroid disease     112134962   09171 Infectious disease: bacterial    05152 Tuberculosis     112134962   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112134962    05161 Hepatitis B     112134962    05160 Hepatitis C     112134962    05171 Coronavirus disease - COVID-19     112134962    05164 Influenza A     112134962    05162 Measles     112134962    05168 Herpes simplex virus 1 infection     112134962    05163 Human cytomegalovirus infection     112134962    05167 Kaposi sarcoma-associated herpesvirus infection     112134962    05169 Epstein-Barr virus infection     112134962    05165 Human papillomavirus infection     112134962  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pon04052]     112134962 Cytokines and growth factors [BR:pon04052]  Cytokines   Interferons    112134962 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112134962 NCBI-ProteinID:  XP_024108413 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFE FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFSTKDSSAAWEQSLLEKFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLTEKKYSPCAWEVVRAEIMRSFSFSTN LQKRIRRKY NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgt tctctgggctgtgatctgcctcagacccacagcctgggtaatagaagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgaa tttccccaggaggaatttgatggcaaccagttgcagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc ctggctgtgaagaaatacttccaaagaatcactgtttatctcacagagaagaaatatagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac ttgcaaaaaagaataaggaggaagtattga

DBGET integrated database retrieval system