KEGG   Pongo abelii (Sumatran orangutan): 100432274
Entry
100432274         CDS       T01416                                 

Gene name
PIP5K1B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04510  Focal adhesion
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05231  Choline metabolism in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100432274 (PIP5K1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100432274 (PIP5K1B)
   04072 Phospholipase D signaling pathway
    100432274 (PIP5K1B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100432274 (PIP5K1B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100432274 (PIP5K1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100432274 (PIP5K1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100432274 (PIP5K1B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100432274 (PIP5K1B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100432274 (PIP5K1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100432274 (PIP5K1B)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     100432274 (PIP5K1B)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100432274 (PIP5K1B)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    100432274 (PIP5K1B)
 Endosome - Golgi transport
  Others
   Others
    100432274 (PIP5K1B)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 100432274
NCBI-ProteinID: XP_009242772
Ensembl: ENSPPYG00000019272
UniProt: H2PSB6
LinkDB
Position
9
AA seq 540 aa
MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETSQNVPDAKRPGMQ
KVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSLSQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHYTHDRPTLYSNSKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtcgtctgctgctgaaaatggagaggcagcacctggaaaacaaaatgaagaaaaaacc
tataaaaagactgcatcatctgctattaaaggtgctattcagctgggaataggatacaca
gtgggtaatctcacttccaagccagaacgagatgttcttatgcaagacttttatgtggtg
gaaagtgtgttcctacccagcgaagggagcaatctgaccccagcacatcactacccagac
tttagatttaagacatacgctccattagcattccgatatttcagagaactttttggtatc
aagcctgatgattacttgtattccatctgcagtgaacctctaatagaactgtctaaccct
ggagccagtggatccttgttttttgtgaccagtgatgatgaatttatcatcaaaacagtt
cagcacaaagaagctgagtttcttcagaagctactgccgggctattacatgaatttaaac
cagaatccaaggactcttttgccaaaattttacggactgtattgtatgcaatcaggaggc
attaatatcaggattgtggtgatgaacaatgttttgccacgctccatgagaatgcacttt
acatatgacttgaaaggctcaacgtataagcgaagagcatcccgtaaagagagagagaaa
tccaaccccacgtttaaggacttagatttcctgcaagacatgcacgaagggttgtatttt
gatacggaaacatacaacgcgcttatgaaaacacttcagagagactgccgggtgctggaa
agcttcaagatcatggactatagccttctgttgggaattcatttcctggaccattccctc
aaagagaaagaggaggagacctcacaaaatgtgcctgatgctaagcggcctgggatgcag
aaggttctctactcaacagccatggaatctatccagggtccagggaaatctggagatggg
ataatcacagagaacccagatacaatgggaggcattccagctaaaagccataggggagaa
aaactacttttatttatgggcattattgacattctgcaatcatataggttaatgaagaag
ttagaacattcctggaaagctcttgtttatgatggggacactgtttccgttcatagacca
agcttttatgcagacagatttctcaagttcatgaattccagagttttcaagaaaattcaa
gctttgaaggcttcaccatctaagaaacggtgcaattcaattgccgccctaaaggccact
tcacaggagattgtgtcctcacttagccaggaatggaaggacgagaagcgagatttgctg
actgaaggacaaagttttagcagccttgatgaagaagccctgggatcccgacacaggcca
gacctggtgcctagcactccgtcactgtttgaagctgcttccttggcgaccacaatttca
tcttcttccttatacgtcaatgagcactatacacacgacaggcctacactctattcaaac
agcaaagggttaccttccagttcaacatttaccttggaagaggggaccatctacttgact
gctgagcccaacactctggaagtgcaggatgacaatgcttctgtgcttgacgtctattta
taa

KEGG   Pongo abelii (Sumatran orangutan): 100435603
Entry
100435603         CDS       T01416                                 

Gene name
PIP5K1C
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 gamma isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04510  Focal adhesion
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05231  Choline metabolism in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100435603 (PIP5K1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100435603 (PIP5K1C)
   04072 Phospholipase D signaling pathway
    100435603 (PIP5K1C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100435603 (PIP5K1C)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100435603 (PIP5K1C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100435603 (PIP5K1C)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100435603 (PIP5K1C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100435603 (PIP5K1C)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100435603 (PIP5K1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100435603 (PIP5K1C)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     100435603 (PIP5K1C)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100435603 (PIP5K1C)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    100435603 (PIP5K1C)
 Endosome - Golgi transport
  Others
   Others
    100435603 (PIP5K1C)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 100435603
NCBI-ProteinID: XP_024093425
LinkDB
Position
19
AA seq 700 aa
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQKALYSTAMES
IQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSERDEAQYDLRGARSYPTLEDEVRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDTGVEAS
PAGASAAVEAETASQASDEEGAPASQASDEEDAPATDIYFWRLWGPHAPTWPWRREGRAT
CLCPPPPHVVTPFPGTGLCVSWSPDGMGGPGAMSCCVSVS
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggagctggaggtgccggacgaggcggagagcgccgaggcgggggccgtgccctcggag
gcggcgtgggcggcagagagcggggcggcggcaggtttggctcagaagaaggcggcccca
acagaggtcctgtccatgacggcacagccgggccctggccatgggaagaagttgggccat
cgaggtgtggacgcatccggcgaaaccacctacaagaagaccacctcctccaccctgaag
ggtgccatccagctgggcatcggctacaccgtgggccacctgagctccaagcctgagcgt
gacgtgctcatgcaggacttctacgtggtggagagcatcttcttccccagcgaaggcagc
aacctcacccccgcccaccacttccaggacttccgcttcaagacctatgcacctgtcgcc
ttccgctacttccgggagctcttcgggatccggccagacgattacttgtactccctgtgc
aatgagccgctgatcgagctgtccaacccgggcgccagtggctccctcttctacgtcacc
agcgacgacgagttcatcatcaagaccgtcatgcacaaggaggccgagttcctgcagaag
ctgctccccggctactacatgaacctcaaccagaacccgcggacgctgctgcccaagttc
tacgggctgtactgtgtgcagtcggggggcaagaacatccgcgtggtggtcatgaacaac
atcctgccccgcgtggtcaagatgcacctcaagttcgacctcaagggctccacctacaag
cggcgcgccagcaagaaggagaaagagaagagcttccccacctacaaggacctggacttc
atgcaggacatgccggaggggctcctgctggacgccgacaccttcagcgccctggtcaag
acgctgcagcgggactgcctggtcctggaaagtttcaagatcatggactacagcctgctg
ctgggcgtgcacaacatcgaccagcacgagcgcgagcggcaggcgcagggcgcccagagc
acctcagatgagaagcggcctgtgggccagaaggcgctgtactccacggccatggagtct
atccagggcggcgccgcacgcggggaggctatcgagtcggatgacacgatgggcgggatc
cccgcggtgaacggccgcggggagcggctgctgctgcacattggcatcatcgacatcctg
cagtcctacaggttcatcaagaaactggagcacacctggaaggccctcgtccacgatggg
gacacggtatccgtccaccgccccagcttctatgccgagcgctttttcaagttcatgagc
aacacggtctttcggaagaactcctccctgaagtcctcgccctccaagaaggggcgcggc
ggagccttgctggctgtgaaacccctggggcccaccgctgccttctcggccagccagatc
cccagcgagcgggacgaggcccagtacgacctgcggggggcccgcagctaccccacgctg
gaggacgaagtccggccggacctcctgccctgcacgccaccttcttttgaagaagccact
acagcctccattgccacgactctgtcatccacatccctctccattcctgagcggtccccc
tcggagacgtcggagcagccgcggtacaggcggcgcacacagtcctccggacaggatggc
aggccgcaggaggagccacccgcggaagaggatctgcagcagattacagtgcaggtggag
cctgcgtgcagcgtggagatcgtggtccccaaagaggaggacacaggggtggaggcttcc
ccggccggtgcctctgccgctgttgaagcagaaactgccagccaggcctcagacgaggag
ggcgcacctgccagccaggcctcggacgaggaggacgcgcccgccaccgacatctacttt
tggcgcctctggggtccccatgcccccacctggccctggagaagggagggacgggccacg
tgcctgtgcccccccccaccccacgtcgtcaccccttttcccgggactggtttgtgcgtg
tcctggtctccggatggtatggggggcccgggggccatgtcgtgctgtgtgtctgtgtcc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100443776
Entry
100443776         CDS       T01416                                 

Definition
(RefSeq) putative PIP5K1A and PSMD4-like protein
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04510  Focal adhesion
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05231  Choline metabolism in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100443776
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100443776
   04072 Phospholipase D signaling pathway
    100443776
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100443776
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100443776
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100443776
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100443776
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100443776
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100443776
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100443776
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     100443776
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100443776
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    100443776
 Endosome - Golgi transport
  Others
   Others
    100443776
SSDB
Motif
Pfam: PIP5K VWA_2 Ssl1
Other DBs
NCBI-GeneID: 100443776
NCBI-ProteinID: XP_009243911
LinkDB
Position
10
AA seq 897 aa
MASASSGPLSSVGFSSFDPAVPSCTSSSASGIKRPMASEVPYASGMPIKKIGHRSVDSSG
ETTSSALKGAIQLGITHTVGSLSTRPESDVLMQDFHMVESIFFPSEGSNLTPAHHYNDFR
FKTYAPVAFRYFWELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYASGDDEFIIKTVRH
KEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKY
DLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADVHNALCKTLQRDCLVLQSF
KIMGYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTME
TDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHHPGFYA
ERFQRFICNTVFKKIPLKPSPSKRFRSGSSSSQRAGSSGNSCITYQPLVSGEHKAQVTTK
AEVEPGVYLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSVDNSEYTRNGD
FLPIRLQAQQDAVNTVCHSKTRSNPENNVGLITLDNDCEVLTTLTPDTGRIPSKLHTVQP
KGKITFCTGIRVAHLALKHRQGNNHKIRIIAFVGNPVEDNEKDLVKLAKCLKKEKVNVDI
INFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISFPILAGEGGAMMGLG
ASDFEFGVDPSADPELALVLRVFMEEQRQRQEEEPRQAAAASAAEAGIATTGTEDSDDAL
LRMTISQQEFGRTGLPDLSSMTEEEKIAYAMQRSPQGAEFGQAESADIDASSAMDTSEPA
KEEDDYDVMQDPEFLQSVLENLPGVDPNNESIRNAMGSPASQATKDGKKDKKEEDKK
NT seq 2694 nt   +upstreamnt  +downstreamnt
atggcgtccgcctcctccgggccgttgtcttcggtcggtttttcatcctttgatcccgcg
gtcccttcctgtacctcgtcctcagcatctggaatcaagagacccatggcatctgaggtg
ccttatgcctctggcatgcccatcaagaaaataggccatagaagtgttgattcctcagga
gagacaacctcatcagccttgaaaggtgccatccagttaggcattacccacactgtgggg
agcctgagtaccagaccagagagtgatgtcctcatgcaagatttccacatggtggagagt
atcttctttcccagtgaagggagcaacctgacccctgctcatcactacaatgactttcgt
ttcaagacctatgcacctgttgccttccgctacttctgggagctatttggtatccggccc
gatgattacttgtattccctctgcagtgagccgctgattgaactttgtagctctggagct
agtggttccctgttctatgcgtccggcgacgatgagttcattattaagacagtccgacat
aaagaggcagagtttctgcagaagctgcttccaggatactacatgaacctcaaccaaaac
cctcggactttgctgcctaaattctatggactgtactgtgtgcaggcaggtggcaagaac
attcggattgtggtgatgaacaatcttttaccaaggtcggtaaaaatgcatatcaaatat
gacctcaaaggctcaacctacaaacggcgggcttcccagaaagagcgagagaagcctctt
cccacatttaaagacctagacttcttacaagacatccctgatggtctttttttggatgct
gacgtgcacaacgccctctgtaagaccctgcagcgtgactgtttggtgctgcagagcttc
aagataatgggttatagcctcttgatgtcaatccataatatagatcatgcacaacgagag
cccttaagcagcgaaacacaatactcagttgatactcgaagaccggccccccaaaaggct
ctgtattccacagccatggaatccatccagggagaggctcgaaggggtggcaccatggag
accgatgaccatatgggtggcatccctgcccggaatagtaaaggggaaaggcttctgctt
tatattggcatcattgacattctacagtcttacaggtttgttaagaagttggagcactct
tggaaagccctggtacatgatggagatactgtctcagtgcatcacccaggcttctacgct
gaacggttccagcgcttcatctgcaacacagtatttaagaagattcccttgaagccttct
ccttccaaaagatttcggtctggctcatcttcctctcagcgagcaggctccagtggcaac
tcctgcattacttaccagccattggtctctggggaacacaaggcacaagtgacaacaaag
gcggaagtggagccaggcgtttaccttggtcgtcctgatgttttacctcagactccacct
ttggaggaaatcagtgagggctcacctattcctgatcccagtttctcacctctagttgga
gagactttgcaaatgctaactacaagtgtggacaacagtgagtatacgcggaatggagac
ttcttacccatccggctgcaggcccagcaggatgctgtcaacacagtttgtcattcaaag
acccgcagcaaccctgagaacaacgtgggccttattacgctggataatgactgtgaagtg
ctgaccacactcaccccagacactggccgtatcccgtccaagctacatactgtccaaccc
aagggcaagatcaccttctgcacgggcatccgcgtggcccatctggctctgaagcaccga
caaggcaacaatcacaagatccgcatcattgcctttgtgggaaacccggtggaggacaat
gagaaagatctggtgaaactggctaaatgcctcaagaaggagaaagtaaatgttgacatt
atcaattttggggaagaggaggtgaacacagaaaaactgacagcctttgtaaacacgttg
aatggcaaagatggaaccggttctcatctggtcacagtgcctccggggcccagtttggct
gatgctctcatcagttttccgattttggctggtgaaggtggtgccatgatgggtcttggt
gccagtgactttgaatttggagtagatcccagtgctgatcctgagctggccttggtcctt
cgtgtatttatggaagagcagcggcagcggcaggaggaggagcccaggcaggcagctgca
gcttctgctgctgaggccgggattgctacgactgggactgaagactcagacgatgccctg
ctgaggatgaccatcagccagcaagagtttggccgcactgggcttcctgacctaagcagt
atgactgaggaagagaagattgcttatgccatgcagaggtccccacagggagcagagttt
ggccaggcagaatcagcagacattgatgccagctcagccatggacacatctgagccagcc
aaggaggaggatgattacgacgtgatgcaggaccctgagttccttcagagtgtcctagag
aacctcccaggtgtggatcccaacaatgaatccattcgaaatgctatgggctccccggcc
tcccaggccaccaaggatggcaagaaggacaagaaggaggaagacaagaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100444466
Entry
100444466         CDS       T01416                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 alpha isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04510  Focal adhesion
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05231  Choline metabolism in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100444466
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100444466
   04072 Phospholipase D signaling pathway
    100444466
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100444466
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444466
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100444466
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100444466
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100444466
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100444466
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100444466
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     100444466
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100444466
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    100444466
 Endosome - Golgi transport
  Others
   Others
    100444466
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 100444466
NCBI-ProteinID: XP_002816448
Ensembl: ENSPPYG00000016213
LinkDB
Position
6
AA seq 612 aa
MVRPPAGPASGSTTCLREAPGGRGGGPQNADSVKTRGEDSTPRTGRGRWKESQAADGEAA
AKMASASSQPSLAVGFSSFDPGAPSCTASSASGIKSPVASEVAYASGKPIKKTGHRGVDS
SGETTYKKTTSSALKGAIQLGITYTVGSLSTKPERDVLMQDFYVVESIFFPSEGGDLTPA
HHYNDFRFKTYAPAAFRYFRELFGIPPDDYLCSLCSEPLIELCSSGASGSLFYVSSDDEF
IIKTLQHKEAEFLQKLLPGYYLNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRS
VKMHIKYDLKGSTYKRQASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTVQRD
CLVLQSFKIMDYSLLLSIHNIDHAQGEPLSSDTLQVSVDTQRLAPQKALYSTAMESIQGE
ARLGDTMETDDHMGGIPAQNSKGERLLLYIGIIDILQSYTFLKKLEHSWKAVVHDGDTVS
VHRPGFYAERFQRFMCNAVFKKIPLKPSPSKKFRSGLSFSPQTGSSGNSCITYQPLVSGE
HKSQVITKVQVEPGVHLGRPDVLPQNPPLEEISEGSPITDHSFSPVVGKTLHMLTTSTTL
EKLECTESEFTH
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggtgcggcctccagccggtccagcatccggctcgacgacgtgtctgagggaggccccg
ggggggcggggaggtggcccgcagaacgcggattctgtaaagacacgtggagaagattcg
actccgagaacaggaagaggcagatggaaagagagccaggcggctgacggggaggcggcc
gccaagatggcgtcagcctcctcccaaccgtcgttggcggtcggtttttcatcctttgat
cccggggccccttcctgtaccgcgtcctcagcatctggaatcaagagccccgtggcatct
gaggtggcttatgcctctggcaagcccatcaagaaaacaggccatcgaggtgttgattcc
tcaggagagacaacatataaaaagacaacctcatcggccttgaaaggtgccatccagtta
ggcattacttacactgtggggagcctgagtaccaaaccagagcgtgatgtcctcatgcaa
gatttctacgtggtggagagtatcttcttccccagtgaagggggcgacctgacccctgct
catcactacaatgactttcgtttcaagacctatgcgcctgctgccttccgctacttccgg
gagctatttggtatcccgcccgatgattacttgtgctccctctgcagtgagccgctgatt
gaactctgtagctctggagctagtggttccctgttctatgtgtccagcgacgatgaattc
attattaagacactccaacataaagaggcggagtttctgcagaagctgcttccaggatac
tacttgaacctcaaccagaaccctcggactttgctgcctaaattctatggactgtactgt
gtgcaggcaggtggcaagaacattcggattgtggtgatgaacaatcttttaccaagatcc
gtcaaaatgcatatcaaatatgacctcaaaggctcaacctacaaacgccaggcttcccag
aaagagcgagagaagcctcttcccacatttaaagatctagacttcttacaagacatccct
gatggtctttttttggatgctgacatgtacaatgctctctgtaagacggtgcagcgtgac
tgtttggtgctgcagagcttcaagataatggactatagcctcttgctgtcaatccacaat
atagatcatgcacaaggagagcccttaagcagcgacactcttcaagtgtcagttgacact
caaagactggccccccaaaaggctctgtattccacagccatggaatccatccagggagag
gctcgactgggcgacaccatggagaccgatgaccatatgggtggcatccctgctcagaat
agtaaaggggaaaggcttctgctttatattggcatcattgacattctacagtcttacaca
tttcttaagaagttggagcactcttggaaagccgtggtacatgacggggacactgtttca
gtgcatcgcccaggcttctatgctgaacggttccagcgcttcatgtgcaatgcagtattt
aagaagatccccttgaagccttctccttccaaaaagtttcggtctggcttatctttctct
ccgcaaacgggctccagtggcaactcctgcattacttaccagccattggtctctggggaa
cacaagtcacaagtgataacaaaggtgcaagtggagccaggtgttcaccttggtcgtcct
gatgttttacctcagaatccacctttggaggaaatcagtgagggctcacctattactgac
cacagtttctcacctgtagttggaaagactttgcatatgctaactacaagtacaaccttg
gaaaagcttgaatgtacagagtcagagttcacccattaa

KEGG   Pongo abelii (Sumatran orangutan): 100456775
Entry
100456775         CDS       T01416                                 

Gene name
PIP5K1A
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 alpha isoform X3
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04510  Focal adhesion
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05231  Choline metabolism in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100456775 (PIP5K1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100456775 (PIP5K1A)
   04072 Phospholipase D signaling pathway
    100456775 (PIP5K1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100456775 (PIP5K1A)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100456775 (PIP5K1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100456775 (PIP5K1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100456775 (PIP5K1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100456775 (PIP5K1A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100456775 (PIP5K1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100456775 (PIP5K1A)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     100456775 (PIP5K1A)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100456775 (PIP5K1A)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    100456775 (PIP5K1A)
 Endosome - Golgi transport
  Others
   Others
    100456775 (PIP5K1A)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 100456775
NCBI-ProteinID: XP_003775627
Ensembl: ENSPPYG00000000872
UniProt: A0A6D2WPZ7 A0A2J8VEZ6
LinkDB
Position
1
AA seq 549 aa
MASASSGPSSSVGFSSFDPAVPSCTSSSASGIKRPMASEVPYASGMPIKKIGHRSVDSSG
ETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHH
YNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFII
KTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVK
MHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCL
VLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARR
GGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHR
PGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKA
QVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKL
EVAESEFTH
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcgtcggcctcctccgggccatcgtcttcggtcggtttttcatcctttgatcccgct
gtcccttcctgtacctcgtcctcagcatctggaatcaagagacccatggcatctgaggtg
ccttatgcctctggcatgcccatcaagaaaataggccatagaagtgttgattcctcagga
gagacaacatataaaaagacaacctcatcagccttgaaaggtgccatccagttaggcatt
acccacactgtggggagcctgagtaccaaaccagagcgtgatgtcctcatgcaagatttc
tacgtggtagagagtatcttctttcccagtgaagggagcaacctgacccctgctcatcac
tacaatgactttcgtttcaagacctatgcacctgttgccttccgctacttccgggagcta
tttggtatccggcccgatgattacttgtattccctctgcagtgagccgctgattgaactc
tgtagctctggggctagtggttccctgttctatgtgtccagcgacgatgagttcattatt
aagacagtccaacataaagaggcggaatttctgcagaagctgcttccaggatactacatg
aacctcaaccagaaccctcggactttgctgcctaaattctatggactgtactgtgtgcag
gcaggtggcaagaacattcggattgtggtgatgaacaatcttttaccaagatcggtaaaa
atgcatatcaaatatgacctcaaaggctcaacctacaaacggcgggcttcccagaaagag
cgagagaagcctcttcccacatttaaagacctagacttcttacaagacatccctgatggt
ctttttttggatgctgacatgtacaatgctctctgtaagaccctgcagcgtgactgtttg
gtgttgcagagcttcaagataatggattatagcctcttgatgtcaatccataatatagat
catgcacaacgagagcccttaagcagcgaaacacaatactcagttgatactcgaagaccg
gccccccaaaaggctctgtattccacagccatggaatccatccagggagaggctcgacgg
ggtggtaccatggagaccgatgaccatatgggtggcatccctgcccggaatagtaaaggg
gaaaggcttctgctttatattggcatcattgacattctacagtcttacaggtttgttaag
aagttggagcactcttggaaagccctggtacatgacggagacactgtctcagtgcatcgc
ccaggcttctacgctgaacggttccagcgcttcatgtgcaacacagtatttaagaagatt
cccttgaagccttctccttccaaaaagtttcggtctggctcatctttctctcggcgagca
ggctccagtggcaactcctgcattacttaccagccatcggtctctggggaacacaaggca
caagtgacaacaaaggcggaagtggagccaggcgttcaccttggtcgtcctgatgtttta
cctcagactccacctttggaggaaatcagtgagggctcgcctattcctgaccccagtttc
tcacctctagttggagagactttgcaaatgctaactacaagtacaaccttggaaaagctt
gaagttgcagagtcagagttcacccattaa

DBGET integrated database retrieval system