KEGG   Pongo abelii (Sumatran orangutan): 100432353
Entry
100432353         CDS       T01416                                 

Gene name
FOXP1
Definition
(RefSeq) forkhead box protein P1 isoform X7
  KO
K23582  forkhead box protein P1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100432353 (FOXP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100432353 (FOXP1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100432353 (FOXP1)
SSDB
Motif
Pfam: FOXP-CC Forkhead Zap1_zf2
Other DBs
NCBI-GeneID: 100432353
NCBI-ProteinID: XP_003776256
Ensembl: ENSPPYG00000013722
UniProt: A0A2J8SWD6
LinkDB
Position
3
AA seq 577 aa
MMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQLLQ
QQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLA
QGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQ
LSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQ
CRVQMQVVQQLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASP
QSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYK
NAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLH
KCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAEN
SIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPL
DPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgatgacacctcaagttatcactccccagcaaatgcagcagatcctccagcaacaagtg
ctgagccctcagcagctccaggttctcctccagcagcagcaggccctcatgcttcaacag
cagcagcttcaagagttttataaaaaacaacaggaacagttgcagcttcaacttttgcaa
caacaacatgctggaaaacagcctaaagagcaacagcaggtggctacccagcagttggct
tttcagcagcagcttttacagatgcagcagttacagcagcagcacctcctgtctttgcag
cgccaaggccttctgacaattcagcccgggcagcctgcccttccccttcaacctcttgct
caaggcatgattccaacagaactgcagcagctctggaaagaagtgacaagtgctcatact
gcagaagaaaccacaggcaacaatcacagcagtttggatctgaccacgacatgtgtctcc
tcctctgcaccttccaagacctccttaataatgaacccacatgcctctaccaatggacag
ctctcagtccacactcccaaaagggaaagtttgtcccatgaggagcacccccatagccat
cctctctatggacatggtgtatgcaagtggccaggctgtgaagcagtgtgcgaagatttc
caatcatttctaaaacatctcaacagtgagcatgcgctggacgatagaagtacagcccaa
tgtagagtacaaatgcaggttgtacagcagttagagctacagcttgcaaaagacaaagag
cgcctgcaagccatgatgacccacctgcatgtgaagtctacagaacccaaagccgcccct
cagcccttgaatctggtatcaagtgtcactctctccaagtccgcatcggaggcttctcca
cagagcttacctcatactccaacgaccccaaccgcccccctgactcccgtcacccaaggc
ccctctgtcatcaccaccaccagcatgcacacggtgggacccatccgcaggcggtactca
gacaaatacaacgtgcccatttcgtcagcagatattgcgcagaaccaagaattttataag
aacgcagaagttagaccaccatttacatatgcatctttaattaggcaggccattctcgaa
tctccagaaaagcagctaacactaaatgaaatctataactggttcacacgaatgtttgct
tacttccgacgcaacgcagccacatggaagaatgcagtgcgtcataatcttagtcttcac
aagtgttttgtgcgagtagaaaacgttaaaggggcagtatggacagtggatgaagtagaa
ttccaaaaacgaaggccacaaaagatcagtggtaacccttcccttattaaaaacatgcag
agcagccacgcctactgcacacctctcaatgcagctttacaggcttcaatggctgagaat
agtatacctctatacactaccgcttccatgggaaatcccactctgggcaacttagccagc
gcaatacgggaagagctgaacggggcaatggagcataccaacagcaacgagagtgacagc
agtccaggcagatctcctatgcaagccgtgcatcctgtacacgtcaaagaagagcccctc
gatccagaggaagctgaagggcccctgtccttagtgacaacagccaaccacagtccagat
tttgaccatgacagagattacgaagatgaaccagtaaacgaggacatggagtga

DBGET integrated database retrieval system