KEGG   Pongo abelii (Sumatran orangutan): 100432582
Entry
100432582         CDS       T01416                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04270  Vascular smooth muscle contraction
pon04350  TGF-beta signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04530  Tight junction
pon04611  Platelet activation
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon05135  Yersinia infection
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100432582 (ROCK1)
   04071 Sphingolipid signaling pathway
    100432582 (ROCK1)
   04024 cAMP signaling pathway
    100432582 (ROCK1)
   04022 cGMP-PKG signaling pathway
    100432582 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100432582 (ROCK1)
   04530 Tight junction
    100432582 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100432582 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100432582 (ROCK1)
   04670 Leukocyte transendothelial migration
    100432582 (ROCK1)
   04062 Chemokine signaling pathway
    100432582 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100432582 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100432582 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    100432582 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432582 (ROCK1)
   05206 MicroRNAs in cancer
    100432582 (ROCK1)
   05205 Proteoglycans in cancer
    100432582 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100432582 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100432582 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100432582 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100432582 (ROCK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100432582 (ROCK1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100432582 (ROCK1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100432582 (ROCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH HR1 Pkinase_C
Other DBs
NCBI-GeneID: 100432582
NCBI-ProteinID: XP_024091694
Ensembl: ENSPPYG00000009051
LinkDB
Position
18
AA seq 1354 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENWVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKCLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENE
ELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcgatttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaatcagagatttacgaatgaaagctgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagggacatcatggcttttgccaacagtccttgggttgttcagcttttt
tatgcattccaagatgatcgttatctctacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgttcctgaaaaatgggcacgattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcacagagatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggcatggtacgatgtgatacagcggttggaacacctgattat
atttcccctgaagtattaaaatcccaaggtggtgatggttattatggaagagaatgtgac
tggtggtcggttggggtatttttatacgaaatgcttgtaggtgatacacctttttatgca
gattctttggttggaacttacagtaaaattatgaaccataaaaattcacttacctttcct
gatgataatgacatatcaaaagaagcaaaaaaccttatttgtgccttccttactgacagg
gaagtgaggttagggcgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gaccagtgggcctgggaaacgctccgagacactgtagcaccagttgtacccgatttaagt
agtgacattgatactagtaattttgatgacttggaagaagataaaggagaggaagaaaca
ttccctattcctaaagcttttgttggcaatcaactaccttttgtaggatttacatattat
agcaatcgtagatacttatcttcagcaaatcctaatgataacagaactagctccaatgca
gataaaagcttgcaggaaagtttgcaaaaaacaatctataagctggaagaacagctgcat
aatgaaatgcagttaaaagatgaaatggagcagaagtgcagaacctcaaacataaaacta
gacaagataatgaaagaattggatgaagagggaaatcaaagaagaaatctagaatctaca
gtgtctcagattgagaaggagaaaatgttgctacagcatagaattaatgagtaccaaaga
aaagctgaacaggaaaatgagaagagaagaaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaagaaagtcagtcagaattcacagcttgctaatgagaagctg
tcccagttacaaaagcagctagaagaagccaatgacttacttaggacagaatcggacaca
gctgtaagattgaggaagagtcacacagagatgagcaagtcaattagtcagttagagtcc
ctgaacagagagttgcaagagagaaatcgaattttagagaattctaagtcacaaacagac
aaagattattaccagctgcaagctatattagaagctgaacgaagagacagaggtcatgat
tctgagatgatcggagaccttcaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaacataatctcgaaaaagtggaaggagaaagaaaagaggctcaagacatgcttaat
cactcagaaaaggaaaagaataatttagagatagatttaaactacaaacttaaatcatta
caacaacggttagaacaagaggtaaatgaacacaaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgtggcaatgtgtgagatggaaaaaaagctg
aaagaagaaagagaagctcgagagaaggctgaaaattgggttgttcagattgagaaacag
tgttccatgctagacgttgatctgaagcaatctcagcagaaactagaacatttgactgga
aataaagaaaggatggaggatgaagttaagaatttaaccctgcaactggagcaggaatca
aataagcggctgttgttacaaaatgaattgaagactcaagcatttgaggcagacaattta
aaatgtttagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagaatttgagttagctcagcttacgaaacagtatagaggaaatgaaggacagatgcgg
gagctacaagatcagcttgaagctgagcaatatttctcgacactttataaaacccaggta
aaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgaaaaagaaactcttgctactcagttggatctagcagaaacaaaagctgag
tctgagcagttggcgcgaggccttctggaagaacagtattttgaattgacacaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacactgttagtcgg
cttgaagaagcaaacagcatgctaaccaaagatattgaaatattaagaagagagaatgaa
gagctaacagagaaaatgaagaaggcagaggaagaatataaactggagaaggaggaggag
atcagtaatcttaaggctgcctttgaaaagaatatcaacactgaacgaacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcgaaaagattttaaaattgatagaaag
aaagctaatacacaagatttgagaaagaaggaaaaggaaaatcgaaagctacaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaaacatcagaaggaactgaat
gacatgcaagcgcaattggtagaagaatgtgcacataggaatgagcttcagatgcagttg
gccagcaaagagagtgatattgagcaattgcgtgctaaacttttggacctctcggattct
acaagtgttgctagttttcctagtgctgatgaaactgatggaaacctcccagagtcaaga
attgaaggttggctttcagtaccaaatagaggaaatatcaaacgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttctataatgacgaacaagataaggag
caatccaatccatctatggtattggacatagataaactgtttcacgttagacctgtaacc
caaggagatgtgtatagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatgtagagatggaaccagtacaacaagctgaaaaa
actaatttccaaaatcacaaaggccatgagtttattcctacactctaccactttcctgcc
aattgtgatgcctgtgccaaacctctctggcatgtttttaagccaccccctgccctagag
tgtcgaagatgccatgttaagtgccacagagatcacttagataagaaagaggacttaatt
tgtccatgtaaagtaagttatgatgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaaaaaatgggtaactcatttagtaaagaaaatccctaagaatcca
ccatctggttttgttcgtgcttcccctcgaacgctttctacaagatccactgcaaatcag
tctttccggaaagtggtcaaaaatacatctggaaaaactagttaa

DBGET integrated database retrieval system