KEGG   Pongo abelii (Sumatran orangutan): 100432733
Entry
100432733         CDS       T01416                                 

Gene name
BIRC7
Definition
(RefSeq) baculoviral IAP repeat-containing protein 7 isoform X2
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04120  Ubiquitin mediated proteolysis
pon04215  Apoptosis - multiple species
pon05145  Toxoplasmosis
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100432733 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100432733 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432733 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100432733 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100432733 (BIRC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100432733 (BIRC7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100432733 (BIRC7)
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I32: IAP family
   100432733 (BIRC7)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100432733 (BIRC7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4 DUF2039 zf-RING_UBOX zf-C3HC4_2 zf-RING_2 ArfGap
Other DBs
NCBI-GeneID: 100432733
NCBI-ProteinID: XP_002830563
Ensembl: ENSPPYG00000011227
UniProt: H2P2K9 A0A6D2X4R0
LinkDB
Position
20
AA seq 280 aa
MGPKDSAKCLHCGPQPSHWAAGDGPAQEHCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLAEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGQQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSLLLGSWDPW
EEPEDAAPAAPSVPASGDPELPTHRREVQSESAQEPGARDVEEQLRRLQEERRCKVCLDR
AVSIVFVPCGHLVCAECAPSLQLCPICRAPVRSRVRTFLS
NT seq 843 nt   +upstreamnt  +downstreamnt
atggggcctaaagacagtgccaagtgcctgcactgtggaccacagccgagccactgggca
gctggtgatggtcccgcacaggagcactgtggaccccgctctctgggcagccctgtccta
ggcctggacacctgcagagcctgggaccacgtggatgggcagatcctgggccagctgcgg
cccctggcagaggaggaagaggaggagggcgccggggccaccttgtccagggggcctgcc
ttccccggcatgggctctgaggagttgcgcctggcctctttctatgactggccgctgacc
gctgaggtgccacccgagctgctggctgctgccggcttcttccacacaggccagcaggac
aaggtgaggtgcttcttctgctacgggggcctgcagagctggaagcgcggggacgacccc
tggaccgagcatgccaagtggttccccagctgtcagttcctgctccggtcaaaaggaaga
gactttgtccacagtgtgcaggagactcactccctgctgctgggctcctgggacccgtgg
gaagaaccggaagatgcagcccctgcggccccctccgtccctgcctctggggaccctgag
ctgcccacgcacagaagagaggtccagtctgaaagcgcccaggagccaggagccagggat
gtggaggagcagctgcggcggctgcaggaggagaggaggtgcaaggtgtgcctggaccgc
gccgtgtccatcgtctttgtgccgtgcggccacctggtctgtgctgagtgtgcccccagc
ctgcagctgtgccccatctgcagagcccccgtccgcagccgcgtgcgcaccttcctgtcc
tag

KEGG   Pongo abelii (Sumatran orangutan): 100449741
Entry
100449741         CDS       T01416                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP isoform X1
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04064  NF-kappa B signaling pathway
pon04120  Ubiquitin mediated proteolysis
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04510  Focal adhesion
pon04621  NOD-like receptor signaling pathway
pon05145  Toxoplasmosis
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100449741 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100449741 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100449741 (XIAP)
   04215 Apoptosis - multiple species
    100449741 (XIAP)
   04217 Necroptosis
    100449741 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100449741 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100449741 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449741 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100449741 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100449741 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100449741 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100449741 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100449741 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100449741 (XIAP)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100449741 (XIAP)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100449741 (XIAP)
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I32: IAP family
   100449741 (XIAP)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100449741 (XIAP)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100449741 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 100449741
NCBI-ProteinID: XP_003779771
Ensembl: ENSPPYG00000020696
UniProt: H2PWP5
LinkDB
Position
X
AA seq 513 aa
MPGPSEKVDKSYFQEKMTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSA
STLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQ
STNSGIQNGQYKVENYLGSRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEE
ARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHF
PNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQL
ARAGFYALGEGDKVKCFHCGGGLTDWKPTEDPWEQHAKWYPGCKYLLEQKGQEYINNIHL
THSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNY
KSLEVLIADLVNAQKDSTQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVP
CGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgcccggcccaagtgaaaaggtggacaagtcctattttcaagagaagatgacttttaac
agttttgaaggatctaaaacttgtgtacctgcagacatcaataaggaagaagaatttgta
gaagagtttaatagattaaaaacttttgctaattttccaagtggtagtcctgtttcagca
tcaacactggcacgagcagggtttctttatactggtgaaggagataccgtgcggtgcttt
agttgtcatgcagctgtagatagatggcaatatggagactcagcagttggaagacacagg
aaagtatccccaaattgcagatttatcaacggcttttatcttgaaaatagtgccacgcag
tctacaaattctggtatccagaatggtcagtacaaagttgaaaactatctgggaagcaga
aatcattttgccttagacaggccttctgagacacatgcagactatcttttgagaactggg
caggttgtagatatatcagacaccatatacccaaggaaccctgccatgtatagtgaagaa
gctagattaaagtcctttcagaactggccagactatgctcacctaaccccaagagagtta
gcaagtgctggactctactacacaggtattggtgaccaagtgcagtgcttttgttgtggt
ggaaaactgaaaaattgggaaccttgtgatcgtgcctggtcagaacacaggcgacacttt
cctaattgcttctttgttttgggccggaatcttaatattcgaagtgaatctgatgctgtg
agttctgataggaatttcccaaattcaacaaatcttccaagaaatccatccatggcagat
tatgaagcacggatctttacttttgggacatggatatactcagttaacaaggagcagctt
gcaagagctggattttatgctttaggtgaaggtgataaagtaaagtgctttcactgtgga
ggagggctaactgattggaagcccactgaagacccttgggaacaacatgctaaatggtat
ccagggtgtaaatatctgttagaacagaagggacaagaatatataaacaatattcattta
actcattcacttgaggagtgtctggtaagaactactgagaaaacaccatcactaactaga
agaattgatgacaccatcttccaaaatcctatggtacaagaagctatacgaatgggtttc
agtttcaaggacattaagaaaataatggaggaaaaaattcagatatctgggagcaactat
aaatcacttgaggttctgattgcagatctagtgaatgctcagaaagacagtacgcaagat
gagtcaagtcagacttcattacagaaagagattagtactgaagagcagctaaggcgcctg
caagaggagaagctttgcaaaatctgtatggatagaaatattgctatcgtttttgttcct
tgtggacatctagtcacttgtaaacaatgtgctgaagcagttgacaagtgtcccatgtgc
tacacagtcattactttcaagcaaaaaatttttatgtcttaa

KEGG   Pongo abelii (Sumatran orangutan): 100457249
Entry
100457249         CDS       T01416                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04064  NF-kappa B signaling pathway
pon04120  Ubiquitin mediated proteolysis
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04621  NOD-like receptor signaling pathway
pon04668  TNF signaling pathway
pon05132  Salmonella infection
pon05145  Toxoplasmosis
pon05168  Herpes simplex virus 1 infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100457249 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100457249 (BIRC3)
   04064 NF-kappa B signaling pathway
    100457249 (BIRC3)
   04668 TNF signaling pathway
    100457249 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100457249 (BIRC3)
   04215 Apoptosis - multiple species
    100457249 (BIRC3)
   04217 Necroptosis
    100457249 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100457249 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100457249 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457249 (BIRC3)
   05202 Transcriptional misregulation in cancer
    100457249 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100457249 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100457249 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100457249 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100457249 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100457249 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100457249 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100457249 (BIRC3)
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I32: IAP family
   100457249 (BIRC3)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100457249 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 OTT_1508_deam zf-RING_UBOX
Other DBs
NCBI-GeneID: 100457249
NCBI-ProteinID: XP_002822440
UniProt: A0A2J8XX29
LinkDB
Position
11
AA seq 604 aa
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPIEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFSGSYSSFPSNPVNSRVNQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIRFEPGEDHSEDAIMMNTPVVNAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTARIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEADAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaatagcatatttttatcaaatttgatgaaaagcgccaacacgttt
gaactgaaatacgacttgtcatgtgaactgtaccgaatgtctacgtattccacttttcct
gctggggttcctgtttcagaaaggagtcttgctcgtgctggtttctattacactggtgtg
aatgacaaggtcaaatgcttctgttgtggcctgatgctggataactggaaaagaggagac
agtcctattgaaaagcataaaaagttgtatcctagctgcagattcgttcagagtctaaat
tcagttaacaacttggaagctacttctcagcctacttttccttcttcagtaacaaattcc
acacactcattacttccaggtacagaaaacagtggatatttcagtggctcttattcaagc
tttccatcaaatcctgtaaactccagagtaaatcaagatttttctgccttgatgagaagt
tcctaccactgtgcaatgaataacgaaaatgccagattacttacttttcagacgtggccg
ttaacttttctgtcaccaacagatctggcaaaagcaggcttttactacataggacctgga
gacagagtggcttgctttgcctgtggtggaaaattgagcaattgggaaccgaaggataat
gctatgtcagaacacctgagacattttcccaaatgcccatttatagaaaatcagcttcaa
gacacttcaagatacacagtttctaatctgagcatgcagacacatgcagcccgctttaaa
acattctttaactggccctctagtgttctagttaatcctgagcagcttgcaagtgcgggt
ttttattatgtgggtaacagtgatgatgtcaaatgcttttgctgtgatggtggactcagg
tgttgggaatctggagatgatccatgggttcaacatgccaagtggtttccaaggtgtgag
tacttgataagaattaaaggacaggagttcatccgtcaagttcaagccagttaccctcat
ctacttgaacagctgctatccacatcagacagcccaggagatgaaaatgcagagtcatca
attattcgttttgaacctggagaagaccattcagaagatgcaatcatgatgaatactcct
gtggttaatgctgccgtggaaatgggctttagtagaagcctggtaaaacagacagttcag
agaaaaatcctagcaactggagagaattatagactagtcaatgatcttgtgttagactta
ctcaatgcagaagatgaaataagggaagaggagagagaaagagcaactgaggaaaaagaa
tcaaatgatttattattaatccggaagaatagaatggcactttttcaacatttgacttgt
gtaattccaatcctggatagtctactaactgccagaattattaatgaacaagaacatgat
gttattaaacagaagacacagacatctttacaagcaagagaattgattgatacgatttta
gtaaaaggaaatattgcagccactgtattcagaaactctctgcaagaagctgacgctgtg
ttatatgagcatttatttgtgcaacaggacataaaatatattcccacagaagatgtttca
gatctaccagtggaagaacaattgcggagactacaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtccatagtgtttattccttgtggtcatctagtagtatgcaaagat
tgtgctccttctttaagaaagtgtcctatttgtaggagtacaatcaagggtacagttcgt
acatttctttcatga

KEGG   Pongo abelii (Sumatran orangutan): 100457858
Entry
100457858         CDS       T01416                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04064  NF-kappa B signaling pathway
pon04120  Ubiquitin mediated proteolysis
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04621  NOD-like receptor signaling pathway
pon04668  TNF signaling pathway
pon05132  Salmonella infection
pon05145  Toxoplasmosis
pon05168  Herpes simplex virus 1 infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100457858 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100457858 (BIRC2)
   04064 NF-kappa B signaling pathway
    100457858 (BIRC2)
   04668 TNF signaling pathway
    100457858 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100457858 (BIRC2)
   04215 Apoptosis - multiple species
    100457858 (BIRC2)
   04217 Necroptosis
    100457858 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100457858 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100457858 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457858 (BIRC2)
   05202 Transcriptional misregulation in cancer
    100457858 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100457858 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100457858 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100457858 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100457858 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100457858 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100457858 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100457858 (BIRC2)
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I32: IAP family
   100457858 (BIRC2)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100457858 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 NikR_C zf-RING_UBOX
Other DBs
NCBI-GeneID: 100457858
NCBI-ProteinID: XP_009245268
Ensembl: ENSPPYG00000003808
UniProt: A0A6D2XY77 A0A2J8XX36
LinkDB
Position
11
AA seq 597 aa
MEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSP
TLEHSSLFSGSYSSLSPNPLNSRAVEDFSSSRTNPYSYAMSTEEARFLTYHMWPLTFLSP
SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSI
SNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDD
PWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPG
ESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEK
REEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQ
IPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQ
LRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggaagatagcacgatcttgtcagattggacaaacagcaacaaacaaaaaatgaagtat
gacttttcctgtgaactctacagaatgtctacatattcaactttccccgccggggttcct
gtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaaggtc
aaatgcttctgttgtggcctgatgctggataactggaaactaggagacagtcctattcaa
aagcataaacagctatatcctagctgtagctttattcagaatctggtttcagctagtctg
ggatccacctctaagaatacatctccaatgagaaacagttttgcacattcgttatctccc
accttggaacatagtagcttgttcagtggttcttactccagcctttctccaaaccctctt
aattctagagcagttgaagacttctcttcatcaaggactaacccctacagttatgcaatg
agtactgaagaagccagatttcttacgtaccatatgtggccattaacttttttgtcacca
tcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgcttt
gcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcagaacaccgg
aggcattttcccaactgtccatttttggaaaattctctagaaactctgaggtttagcatt
tcaaatctgagcatgcagacacatgcagctcgaatgagaacatttatgtactggccatct
agtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgcaat
gatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagatgat
ccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgaatgaaaggc
caagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttgtca
acttcagataccactggagaagaaaatgctgacccaccaattattcattttggacctgga
gaaagttcttcagaagatgctgtcatgatgaatacacctgtggttaaatctgccctggaa
atgggctttaatagagacctggtgaaacaaacagttcaaagtaaaatcctgacaactgga
gagaactacaaaacagttaatgatattgtatcagcacttcttaatgctgaagatgaaaaa
agagaagaggagaaggaaaaacaagctgaagaaatggcatcagatgatttgtcattaatt
cggaagaatagaatggctctctttcaacaattgacgtgtgtgcttcctatcctggataat
cttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaacacag
atacctttacaagcgagagaactgattgataccattttggttaaaggaaatgctgcggcc
aacatcttcaaaaactgtctaaaagaaattgactctacactgtataagaacttatttgtg
gataagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaagaacaa
ttgaggagattgcaagaagaacgaacttgtaaagtgtgtatggacaaagaagtttctatt
gtatttattccttgtggtcatctggtagtatgccaggaatgtgccccatctctaagaaaa
tgccctatttgcaggggtataatcaagggtactgttcgtacatttctctcttaa

KEGG   Pongo abelii (Sumatran orangutan): 100937717
Entry
100937717         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase XIAP
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04120  Ubiquitin mediated proteolysis
pon04215  Apoptosis - multiple species
pon05145  Toxoplasmosis
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100937717
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100937717
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100937717
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100937717
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100937717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100937717
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100937717
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I32: IAP family
   100937717
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100937717
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2
Other DBs
NCBI-GeneID: 100937717
NCBI-ProteinID: XP_009231351
LinkDB
Position
19
AA seq 533 aa
MSGFGISNGRGFGPPLRGTLPLGQGRSPGRLEPLSWSETVDKSYIQEKITLNSFEGSKTY
VSADINEDEELVEEINRXNTFAGFAGGGSAWASXRDGGDALRGLSCPEAVDRWQRGGSAV
DRHKKAAPNCRFIRSFYFENSATKPANLGVPNGQYQAENHLGEEKHCALDRPSETRADRL
LRTGQVVDRXDSIHPRSPAMHSEEARLKSFHNWPASAHLTPRELXYYTGTDDQVQCFCCG
GKLKNWEPGDCAWSEHRRHFPNCFFILGHNVNIRGESDVASSDRNFSNXTNSPRNPSMTG
YEARLITFGTWMXSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWY
PGCKYLLEEKGHEYINNIHLTRSLEGSLVKTTKKTPSLTKRISDTIFPNPMLQEAIRMGF
CFKDIKKIMEEKIXTSGSNYKTLEVLVADLVSTQKDTTENESNQTSXQREISPEELLRRL
QEEKLCKICMDRHTAVVFIPCGHLVTCKQCAEAVDRCPMCSAVITFKQRVFMS
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgtccgggtttggcatttccaatggtagggggttcgggccgcccctccgcgggaccctt
ccgttgggacaaggccgatcgcctgggcggttggagccgctatcctggagcgagacggtg
gacaagtcctatattcaagagaagataactttgaacagtttcgaaggatctaaaacctat
gtgtctgcagacatcaatgaggatgaagaattagtagaagagattaatagatgaaacacg
tttgctggctttgcaggtggtgggtctgcctgggcatcgnngcgcgatggaggcgacgcc
ctgaggggccttagctgccctgaagctgtagacaggtggcaacgtggaggctcagcagtt
gacagacacaagaaagcagcgccgaactgcaggtttatccgcagcttttattttgaaaac
agtgccacgaaacctgcaaatcttggtgtcccaaatggtcaataccaagctgaaaaccat
ctgggagaggaaaagcattgtgctttagacaggccgtctgagactcgtgcagaccggctt
ttgagaactggacaggtggtggatagatgagactccatacacccgaggagccccgccatg
catagtgaagaagctagattaaagtcgtttcacaactggccagcctctgcccacttgacc
ccaagagagctgngctactacacaggcactgatgaccaagtgcagtgcttctgttgtggc
ggaaaactgaaaaactgggaacctggtgattgtgcctggtcagaacacaggagacatttt
cctaattgcttctttattttgggccacaacgttaatattcgaggtgaatctgatgttgcg
agttctgataggaatttctcaaatntaacaaattcgccaaggaatccatccatgacaggt
tatgaagcccggctcattacttttgggacatggatgtagtccgttaacaaagagcagctt
gcaagagctggattttatgctataggtcaagaggataaagtacagtgctttcattgtgga
ggagggctagccaactggaagcccaaggaagacccttgggaacaacatgctaaatggtat
ccaggctgcaagtatctgctagaagagaagggacatgaatatataaacaacattcattta
acccgttcacttgagggatctctggtaaaaactaccaagaaaacaccatcactaactaaa
agaatcagtgataccatcttccctaatcctatgctacaagaagctatacgaatgggattc
tgtttcaaggacattaagaaaataatggaggaaaaaatttaaacatctgggagcaactat
aaaacgcttgaggttcttgttgcagatctggtgagcactcagaaagacactacagaaaat
gaatccaatcagacttcatagcagagagagatcagccctgaagagctgctaaggcgtctg
caagaggagaagctttgtaaaatctgcatggacagacataccgctgtcgtttttattcct
tgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacagatgtcccatgtgc
agtgcagtcattactttcaagcaaagagtttttatgtcttaa

DBGET integrated database retrieval system