KEGG   Pongo abelii (Sumatran orangutan): 100432920
Entry
100432920         CDS       T01416                                 

Gene name
VCL
Definition
(RefSeq) vinculin isoform X1
  KO
K05700  vinculin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100432920 (VCL)
   04520 Adherens junction
    100432920 (VCL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100432920 (VCL)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100432920 (VCL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100432920 (VCL)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100432920 (VCL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100432920 (VCL)
   04147 Exosome [BR:pon04147]
    100432920 (VCL)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100432920 (VCL)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100432920 (VCL)
SSDB
Motif
Pfam: Vinculin CARD
Other DBs
NCBI-GeneID: 100432920
NCBI-ProteinID: XP_024109837
LinkDB
Position
10
AA seq 1066 aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGL
DVLTAKVENAARKLEAMTTSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRA
VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD
LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEG
IQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDE
VTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQAT
EMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3201 nt   +upstreamnt  +downstreamnt
atgccagtgtttcatacgcgcacgatcgagagcatcctggagccggtggcacagcagatc
tcccacctggtgataatgcacgaggagggcgaggtggacggcaaagccattcctgacctc
acagcgcccgtggccgccgtgcaggcggccgtcagcaacctcgtccgggttggaaaagag
actgttcaaaccactgaggatcagattttgaagagagatatgccaccagcatttattaag
gttgagaatgcttgcaccaagcttgtccaggcagctcagatgcttcagtcagacccttac
tcagtgcctgctcgagattatctaattgatgggtcaaggggcatcctctctggaacatca
gacctactccttaccttcgatgaggctgaggtccgtaaaattattagagtttgcaaagga
attttggaatatcttacagtggcagaggtggtggagactatggaagatttggtcacttac
acaaagaatcttgggccaggaatgactaagatggccaagatgattgacgagagacagcag
gagctgactcaccaggagcaccgagtgatgttggtgaactcgatgaacaccgtgaaagag
ttgctgccagttctcatttcagctatgaagatttttgtaacaactaaaaactcaaaaaac
caaggcatagaggaagctttaaaaaatcgcaattttactgtagaaaaaatgagtgctgaa
attaatgagataattcgtgtgttacaactcacctcttgggatgaagatgcctgggccagc
aaggacactgaagccatgaagagagcattggcctccatagattccaaactgaaccaggcc
aaaggttggctccgtgaccctagtgcctccccaggggatgctggtgagcaggccatcaga
cagatcttagatgaagctggaaaagttggtgaactctgtgcaggcaaagaacgcagggag
attctgggaacttgcaaaatgctagggcagatgactgatcaagtggctgacctccgtgcc
agaggacaaggatcctcaccggtggccatgcagaaagctcagcaggtatctcagggtctg
gatgtgctcaccgcaaaagtggaaaatgcagctcgcaagctggaagccatgaccacctca
aagcagagcattgcaaagaagatcgatgctgctcagaactggcttgcagatccaaatggt
ggaccggaaggagaagagcagattcgaggtgctttggctgaagctcggaaaatagcagaa
ttatgtgatgatcctaaagaaagagatgacattctacgttcccttggggaaatatctgct
ctgacttctaaattagcagatctacgaagacaggggaaaggagattctccagaggctcga
gccttggccaaacaggtggccacggccctgcagaacctgcagaccaaaaccaaccgggct
gtggccaacagcagacctgccaaagcagctgtacaccttgagggcaagattgagcaagca
cagcggtggattgataatcccacagtggatgaccgtggagtcggtcaggctgccatcagg
gggcttgtggccgaagggcatcgtctggctaatgttatgatggggccttatcggcaagat
cttctcgccaagtgtgaccgagtggaccagctgacagcccagctggctgacctggctgcc
agaggggaaggggagagtcctcaggcgcgagcacttgcatctcagctccaagactcctta
aaggacctaaaagctcggatgcaggaggctatgactcaggaagtgtcagatgttttcagt
gataccacaactcccatcaagctgttggcagtggcagccacggcacctcctgatgcgcct
aatagggaagaggtatttgatgagagggcagctaactttgaaaaccattcaggaaagctt
ggtgctacggccgagaaggcggctgcggttggtactgctaataaatcaacagtggaaggc
attcaggcctcagtgaagacggcccgagaactcacaccccaggtggtctcggctgctcgt
atcttacttaggaaccctggaaatcaagctgcttatgaacattttgagaccatgaagaac
cagtggatcgataatgttgaaaaaatgacagggctggtggacgaagccattgataccaaa
tctctgttggatgcttcagaagaagcaattaaaaaagacctggacaagtgcaaggtagct
atggccaacattcagcctcagatgctggttgctggggcaaccagcattgctcgtcgggcc
aaccggatcctgctggtggctaagagggaggtggagaattccgaggatcccaagttccgt
gaggctgtgaaagctgcctctgatgaattgagcaaaaccatctccccgatggtgatggat
gcaaaagctgtggctggaaacatttctgaccctggactgcaaaagagcttcctggactca
ggatatcggatcctgggagctgtggccaaggtcagagaagccttccaacctcaggagcct
gacttcccgccgcctccaccagaccttgaacaactccgactaacagatgagcttgctcct
cccaaaccacctctgcctgaaggtgaggtccctccacctaggcctccaccaccagaggaa
aaggatgaagagttccctgagcagaaggccggggaggtgattaaccagccaatgatgatg
gctgccagacagctccatgatgaagctcgcaaatggtccagcaagggcaatgacatcatt
gcagcagccaagcgcatggctctgctcatggctgagatgtctcggctggtaagagggggc
agtggtaccaagcgggcactcattcagtgtgcgaaggacatcgccaaggcctcagacgag
gtgactcggttggccaaggaggttgccaagcagtgcacagataaacggattagaaccaac
ctcttacaggtatgtgagcgaatcccaaccataagcacccagctcaaaatcctgtccaca
gtgaaggccaccatgctgggccggaccaacatcagtgatgaggagtctgagcaggccaca
gagatgctggttcacaacgctcagaacctcatgcagtctgtgaaggagactgtgcgggaa
gcagaagctgcttcaatcaaaattcgaacagatgctggatttacactgcgctgggttaga
aagactccctggtaccagtag

DBGET integrated database retrieval system