KEGG   Pongo abelii (Sumatran orangutan): 100432929
Entry
100432929         CDS       T01416                                 

Gene name
EIF4B
Definition
(RefSeq) eukaryotic translation initiation factor 4B isoform X1
  KO
K03258  translation initiation factor 4B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03013  RNA transport
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100432929 (EIF4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100432929 (EIF4B)
   04150 mTOR signaling pathway
    100432929 (EIF4B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100432929 (EIF4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100432929 (EIF4B)
   03012 Translation factors [BR:pon03012]
    100432929 (EIF4B)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100432929 (EIF4B)
   mRNA cycle factors
    Stress granule specific factors
     100432929 (EIF4B)
Translation factors [BR:pon03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    100432929 (EIF4B)
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 100432929
NCBI-ProteinID: XP_024112556
LinkDB
Position
12
AA seq 616 aa
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG
YRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED
RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSTRAASI
FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT
GSESSQTGTSTTSGRSKSDQDARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMP
APPPKENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPARKDENKVDGMNV
PKGQTGNSSRGPGDGGNKDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAA
LSVDGEDENEGEDYAE
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggcggcctcagcaaaaaagaagaataagaaggggaagactatctccctaacagacttt
ctggctgaggatgggggtactggtggaggaagcacctatgtttccaaaccagtcagctgg
gctgatgaaacagatgacctggaaggagatgtttcaacaacttggcacagtaacgatgac
gatgtgtatagggcgcctccaattgaccgttccatccttcccactgctccacgggctgct
cgggaacccaatatcgaccggagccgtcttcccaaatcgccaccctacactgcttttcta
ggaaacctaccctatgatgttacagaagagtcaattaaggaattctttcgaggattaaat
atcagtgcagtgcgtttaccacgtgaacccagcaatccagagaggttgaaaggttttggt
tatgctgaatttgaggacctggattccctgctcagtgccctgagtctcaatgaagagtct
ctaggtaacaggagaattcgagtggacgttgctgatcaagcacaggataaagacagggat
gatcgttcttttggccgtgatagaaatcgggattctgacaaaacagatacagactggagg
gctcgtcctgctacagacagctttgatgactacccacctagaagaggtgatgatagcttt
ggagacaagtatcgagatcgttatgattcagaccggtatcgggatgggtatcgggatggg
tatcgggatggcccacgccgggatatggatcgatatggtggccgggatcgctatgatgac
cgaggcagcagagactatgatagaggctatgattcccggataggcagtggcagaagagca
tttggcagtgggtatcgcagggatgatgactacagaggaggcggggaccgctatgaagac
cgatatgacagacgggatgatcggtcgtggagctccagagatgattactctcgggatgat
tataggcgtgatgatagaggtcccccccaaagacccaaactgaatctaaagcctcggagt
actcctaaggaagatgattcctctgctagtacctcccagtccactcgagctgcttctatc
tttggaggggcaaagcccgttgacacagctgctagagaaagagaagtagaagaacggcta
cagaaggaacaagagaagttgcagcgtcagctggatgagccaaaactagaacgacggcct
cgggagagacacccaagctggcgaagtgaagaaactcaggaacgggaacggtcaaggaca
ggaagtgagtcatcgcagactgggacctccaccacatctggcagaagtaagtcagaccag
gatgcacgaaggagagagagtgaaaagtctctagaaaatgaaacactcaataaggaggaa
gattgccactctccaacttctaaacctcccaaacctgatcagcccctaaaggtaatgcca
gcccctccaccaaaggagaatgcttgggtgaagcgaagttctaaccctcctgctcgatct
cagagctcagacacagagcagcaatcccctacaagtggtgggggaaaagtagctccagct
caaccatctgaggaaggaccagcaaggaaagatgaaaataaagtagatgggatgaatgtc
ccaaaaggccaaactgggaactctagccgtggtccaggagacggagggaacaaagaccac
tggaaggagtcagataggaaagatggcaaaaaggatcaagactccagatctgcacctgag
ccaaagaaacctgaggaaaatccagcttccaagttcagttctgcaagcaagtatgctgct
ctctctgttgatggtgaagatgaaaatgagggagaagattatgccgaatag

DBGET integrated database retrieval system