KEGG   Pongo abelii (Sumatran orangutan): 100432978Help
Entry
100432978         CDS       T01416                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03030  DNA replication
pon03410  Base excision repair
pon03420  Nucleotide excision repair
pon03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100432978 (LIG1)
   03410 Base excision repair
    100432978 (LIG1)
   03420 Nucleotide excision repair
    100432978 (LIG1)
   03430 Mismatch repair
    100432978 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pon03032]
    100432978 (LIG1)
   03400 DNA repair and recombination proteins [BR:pon03400]
    100432978 (LIG1)
Enzymes [BR:pon01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100432978 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100432978 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100432978 (LIG1)
DNA replication proteins [BR:pon03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100432978 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100432978 (LIG1)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100432978 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100432978 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     100432978 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C Presenilin DDR
Motif
Other DBs
NCBI-GeneID: 100432978
NCBI-ProteinID: XP_024092288
Ensembl: ENSPPYG00000010188
LinkDB All DBs
Position
19
AA seq 919 aa AA seqDB search
MQRSIMSFFHPKKESKVKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
AQVLGSEGEEEDEALSPAKGQKPAPDCSQVSPPCPATSPENNASLSDTPPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSEDEDRDAKRKKEEEEAETTKESLTEAEVATEKEGEDGDQ
PTTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPPRAPKTLSSFFTPRKPAIK
KEVKEEKPGAPGKEGTAEGPLDPCGYNPAKNNYHPLEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRHLESVRAEAAEKGDMGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACHHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDHEKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLNGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagtatcatgtcatttttccaccccaagaaagagagtaaagtgaagaagcct
gagaaggaggcatccaacagcagcagagagacggagccgcctccaaaggcggcactgaag
gagtggaatggagtggtgtccgagagtgactctccagtgaagaggccagggaggaaggcg
gcccaggtcctgggcagcgaaggggaagaggaggatgaagcccttagccctgctaaaggc
cagaagcctgccccagactgctcacaggtctccccgccctgtcctgccacatctcctgaa
aacaacgcttccctctctgacacccctcccatggacagttccccatcagggatcccgaag
cgtcgcacagctcggaagcagctcccgaaacggaccattcaggaagtcctggaagagcag
agtgaggacgaggacagagacgccaagaggaagaaggaggaggaagaagcagagaccacg
aaagaaagcctcacagaggctgaagtggcaacagagaaggaaggagaagacggggaccag
cccaccacgcctcccaagcccctgaagacctccaaagcagagaccccgacggaaagcgtt
tcagagcctgaggtggccacaaagcaggaactgcaggaggaggaggagcagaccaagcct
cccccgagagctcccaagacgctcagcagcttcttcaccccccggaagccagcaatcaaa
aaagaagtgaaggaagagaagccgggggctccaggaaaggagggaactgctgagggaccc
ttggacccatgcggttacaatcctgccaagaacaactatcatcccttggaagatgcctgc
tggaaaccgggccagaaggtcccttacctggccgtggcccggacgtttgagaagatcgag
gaggtgtctgctcggctccggatggtggagacgctgagcaacttgctgcgctccgtggtg
gccctgtcgcctccagacctcctccctgtcctctacctcagcctcaaccaccttgggcca
ccccagcagggcctggagcttggcgtgggtgatggcgtccttctcaaggcggtggcccag
gccacaggtcggcatctggagtccgtccgggctgaggcagccgagaaaggcgacatgggg
cttgtggccgagaatagccgcagcacccagaggctcatgctgccaccacctccactcact
gcctccggggtcttcagcaagttccgcgacatcgccaggctcaccggcagtgcttccaca
gccaagaagatagacatcatcaaaggcctctttgtggcctgccaccactcagaagcccgg
ttcatcgccaggtccctgagcggacggctgcgccttgggctggcagagcagtcggtgctg
gccgccctctcccaagccgtgagcctcacgcccccgggccaagaattcccaccagccgtg
gtggatgctgggaagggcaagacagcagaggcccgaaagacttggctggaggagcaaggc
atgatcctaaagcagacattctgcgaggttcccgacctggaccgaattatccccgtgctg
ctggagcacggcctggaacgtctcccggagcactgcaagctgagcccagggattcccctg
aaaccaatgttggcccatcccacgcggggcgtcagcgaggtcctgaaacgctttgaggag
gcagctttcacctgtgaatacaaatatgatgggcagagggcacagatccacgccctggaa
ggcggggaggtgaagatcttcagcaggaatcaggaagacaacactgggaagtacccggac
atcatcagccgcatccccaagattaaacttccatcggtcacatcctttatcctggacacc
gaagctgtggcttgggaccatgaaaagaagcagatccagccattccaagtgctcaccacc
cgcaaacgcaaggaggtggatgcgtccgagatccaggtgcaggtgtgtttgtacgccttc
gacctcatctacctcaatggagagtccctggtacgtgagcccctttcccggcgccggcag
ctgctccgggagaactttgtggagacggagggcgagtttgtcttcgccacctccctggac
accaaggacgtcgagcagatcgctgagttcctggagcagtcggtgaaagactcctgcgag
gggctgatggtgaagaccctggatgttgatgccacctacgagatcgccaagagatcgcac
aactggctcaagctgaagaaggactaccttaatggcgtgggtgacaccctggacctggtg
gtgatcggcgcctacctgggccgggggaagcgggccggccggtacgggggcttcctgttg
gcctcctacgacgaggacagtgaggagctgcaggccatatgcaagcttggaactggcttc
agcgacgaggagctggaggagcatcaccagagcctcaaggccctggtgctgcccagccca
cgcccttacgtgcggatagatggtgctgtgattcccgaccactggctggaccccagcgcc
gtgtgggaggtgaagtgtgctgacctctccctctcccccatctaccctgctgcgcggggc
ctggtggatagtgacaaggggatctcccttcgcttccctcggtttattcgagtccgtgaa
gacaagcagccggagcaggccaccaccagtgcccaggtggcctgtttgtaccggaagcaa
agtcagattcagaaccaacaaggcgaggactcaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system