KEGG   Pongo abelii (Sumatran orangutan): 100432995
Entry
100432995         CDS       T01416                                 

Gene name
NRG2
Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform isoform X1
  KO
K05456  neuregulin 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04012  ErbB signaling pathway
pon05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100432995 (NRG2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100432995 (NRG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100432995 (NRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100432995 (NRG2)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100432995 (NRG2)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 C2-set_2 V-set Ig_6 EGF DUF3169
Other DBs
NCBI-GeneID: 100432995
NCBI-ProteinID: XP_024103308
LinkDB
Position
5
AA seq 853 aa
MRQVCCSALPPPPLEKGRCSSYSDSSSSSERSSNSSSSSSENGSSSRSSSNNSSISRPAA
PPEPRPQKQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQ
DQAYKAPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVIS
VGSCAPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKK
MKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKV
KVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYY
IEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKHLGFELKEAEELYQKRVLTITGIC
VALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADY
ISKNVPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDS
QSGIMLSSVGTSKCNSPACVEARARRAAAHNLEERRRATAPPYHDSVDSLRDSPHSERYV
SALTTPARLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLAEQQPLLRHPAP
PGPGPGPGPGADMQRSYDSYYYPAAGPGPRRGTCALGGSLGSLPASPFRIPEDDEYETTQ
ECAPPPPPRPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASAS
DDDADDADGALAAESTPFLGLRGAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSR
GPPPRAKQDSAPL
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgcggcaggtttgctgctcagcgctgccgccgccgccactggagaagggtcggtgcagc
agctacagcgacagcagcagcagcagcgagaggagcagcaacagcagcagcagcagcagc
gagaacggcagcagcagcaggagcagcagcaacaacagcagcatctctcgtcccgctgcg
cccccagagccgcggccgcagaaacagccgcagccccgcagccccgcagcccggagagcc
gccgcccgttcgcgagcagcagccgccggcggcatgaggcgcgacccggcccccggcttc
tccatgctgctcttcggtgtgtcgctcgcctgctactcgcccagcctcaagtcagtgcag
gaccaggcgtacaaggcacccgtggtggtggagggcaaggtacaggggctggccccagcc
ggcggctccagctccaacagcacccgagagccgcccgcctcgggtcgggtggcgttggta
aaggtgctggacaagtggccgctccggagcggggggctgcagcgcgagcaggtgatcagc
gtgggctcctgtgcgccgctcgaaaggaaccagcgctacatctttttcctggagcccacg
gaacagcccttagtctttaagacggcctttgcccctctcgataccaacggcaaaaatctc
aagaaagaggtgggcaagatcctgtgcactgactgcgccacccggcccaagttgaagaag
atgaagagccagacgggacaggtgggtgagaagcaatcgctgaagtgtgaggcagcagcc
ggtaatccccagccttcctaccgttggttcaaggatggcaaggagctcaaccgcagccga
gacattcgcatcaaatatggcaatggcagaaagaactcacgactacagttcaacaaggtg
aaggtggaggacgctggggagtatgtctgcgaggccgagaacatcctggggaaggacacc
gtccggggccggctttacgtcaacagcgtgagcaccaccctgtcatcctggtcggggcat
gcccggaagtgcaacgagacagccaagtcctattgtgtcaatggaggcgtctgctactac
atcgagggcatcaatcagctctcctgcaaatgtccaaatggattcttcggacagagatgt
ttggagaaactgcctttgcgattgtacatgccagatcctaagcaaaagcaccttggattt
gaattaaaggaagccgaggagctgtaccagaagagagtcctgaccatcacgggcatctgc
gtggctctgctggtcgtgggcatcgtctgtgtggtagcctactgcaagaccaaaaaacag
cggaagcagatgcacaaccacctccggcagaacatgtgcccggcccatcagaaccggagc
ttggccaatgggcccagccacccccggctggacccagaggagatccagatggcagattat
atttccaagaacgtgccagccacagaccatgtcatcaggagagaaactgagaccaccttc
tctgggagccactcctgttctccttctcaccactgctccacagccacacccacctccagc
cacagacatgagagccacacgtggagcctggaacgttctgagagcctgacttctgactcc
cagtcggggatcatgctatcatcagtgggtaccagcaaatgcaacagcccagcatgtgtg
gaggcccgggcaaggcgggcagcagcccacaacctggaggagcggcgcagggccaccgcg
ccaccctatcacgattccgtggactcccttcgcgactccccacacagtgagaggtacgtg
tcggccctgaccacgcccgcgcgcctctcgcccgtggacttccactactcgctggcgacg
caggtgccaactttcgagatcacgtcccccaactcggcgcacgccgtgtcgctgccgccg
gcggcacccatcagttaccgcctggccgagcagcagccgttactgcggcacccggcgccc
cccggcccgggacccgggcccgggcccggcgcagacatgcagcgcagctacgacagctac
tattaccccgcggcggggcccggaccgcggcgcgggacctgcgcgctcggcggtagcctg
ggcagcctgcccgccagccccttccgcatcccggaggacgacgagtacgagaccacgcag
gagtgcgcgcccccgccgccgccgcggccgcgcgcgcgcggtgcgtcccgcaggacgtcg
gcggggccccggcgctggcgccgctcgcgcctcaatgggctggcggcgcagcgcgcacgg
gcggcgcgggactcgctgtcgctgagcagcggctcgggcggcggctcggcatcggcgtcg
gacgacgacgcggacgacgcggacggggcgctggcggccgagagcacgcctttcctgggc
ctgcgcggggcgcacgacgcgctgcgctcggactcgccgccactgtgcccggcggccgac
agcaggacttactactccctggacagccacagcacgcgggccagcagcagacacagccgc
gggccgcccccgcgggccaagcaggactcggcgccactctag

DBGET integrated database retrieval system