KEGG   Pongo abelii (Sumatran orangutan): 100433083
Entry
100433083         CDS       T01416                                 

Gene name
TCL1B
Definition
(RefSeq) T-cell leukemia/lymphoma protein 1B
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100433083 (TCL1B)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 100433083
NCBI-ProteinID: XP_002825121
Ensembl: ENSPPYG00000006118
UniProt: A0A2J8TLE5
LinkDB
Position
14
AA seq 135 aa
MASEASVRLGVPPDRLWIRRPGIYEDEEGRTWVTVVVRFNPSHREWARASSSQGSASQGS
RYEPSITVHLWQLAVHTREPLSSGQMPFSQLPAVWQLYPGKKYRAADSSFWEIADHGQID
SMEQLVLTYQPERKD
NT seq 408 nt   +upstreamnt  +downstreamnt
atggcctccgaagcttctgtgcgtctaggggtgccccctgatcgtctgtggatccggagg
cctggcatctacgaagatgaggaggggaggacctgggtgactgtggtcgtgcggttcaat
ccctcgcatagggaatgggccagggcctcaagctcccagggcagcgcctcccagggcagc
agatatgaacccagcatcacggtgcacttgtggcagttggcagtgcacacccgggagcca
ctctcctctggccagatgcccttctcccagctgcccgccgtgtggcagctctaccctggg
aagaagtaccgagcagcggattccagtttctgggaaatagcagaccatggccagatcgac
tccatggagcagctggtcctaacatatcagccagagaggaaagactga

KEGG   Pongo abelii (Sumatran orangutan): 100433470
Entry
100433470         CDS       T01416                                 

Gene name
TCL1A
Definition
(RefSeq) T-cell leukemia/lymphoma protein 1A
  KO
K10167  T-cell leukemia/lymphoma 1A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100433470 (TCL1A)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 100433470
NCBI-ProteinID: XP_024087739
Ensembl: ENSPPYG00000006119
LinkDB
Position
14
AA seq 114 aa
MAECPILGEAVTDHPDRLWAWEKFVYLDEKQRAWLPLTIEIKDRLQLRVLLRQEDVVLGS
PMTPTQIGPSLLPVMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
NT seq 345 nt   +upstreamnt  +downstreamnt
atggccgagtgcccgatactcggggaggcagtcaccgaccacccggaccgcctgtgggcc
tgggagaagttcgtgtatttggacgagaagcagcgtgcctggctgcccttaaccatcgag
ataaaggataggttacagttacgggtgctcttgcgtcaggaagacgttgtcctggggagt
cctatgacccccacccagataggcccaagcctgctgcctgtcatgtggcagctctaccct
gatggacgataccgatcctcagactccagtttctggcgcttagtgtaccacatcaagatt
gacggcgtggaggacatgcttctcgagctgctgccagatgactga

KEGG   Pongo abelii (Sumatran orangutan): 100454912
Entry
100454912         CDS       T01416                                 

Gene name
MTCP1
Definition
(RefSeq) protein p13 MTCP-1
  KO
K16837  mature T-cell proliferation-1 type B1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100454912 (MTCP1)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 100454912
NCBI-ProteinID: XP_009233718
Ensembl: ENSPPYG00000020898
UniProt: A0A6D2WNA5 A0A2J8RMD9
LinkDB
Position
X
AA seq 107 aa
MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHL
LTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcaggagaggatgtgggggctccacccgatcacctctgggttcaccaagagggtatc
taccgcgacgaataccagcgcacgtgggtggccgtcgtggaagaggagacgagtttccta
agggcacgagtccagcaaattcaggttcccttaggtgacgcagctaggccaagtcacctt
cttacctcccagctacctctcatgtggcaactctacccggaggagcgctacatggataac
aactctcgcttgtggcagatacagcatcatttaatggtcaggggagtacaggagctgttg
cttaagcttttgcctgatgactaa

DBGET integrated database retrieval system