KEGG   Pongo abelii (Sumatran orangutan): 100433126
Entry
100433126         CDS       T01416                                 

Gene name
FGFR3
Definition
(RefSeq) LOW QUALITY PROTEIN: fibroblast growth factor receptor 3
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05219  Bladder cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100433126 (FGFR3)
   04014 Ras signaling pathway
    100433126 (FGFR3)
   04015 Rap1 signaling pathway
    100433126 (FGFR3)
   04020 Calcium signaling pathway
    100433126 (FGFR3)
   04151 PI3K-Akt signaling pathway
    100433126 (FGFR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100433126 (FGFR3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100433126 (FGFR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100433126 (FGFR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433126 (FGFR3)
   05206 MicroRNAs in cancer
    100433126 (FGFR3)
   05230 Central carbon metabolism in cancer
    100433126 (FGFR3)
  09162 Cancer: specific types
   05219 Bladder cancer
    100433126 (FGFR3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100433126 (FGFR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100433126 (FGFR3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100433126 (FGFR3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100433126 (FGFR3)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100433126 (FGFR3)
CD molecules [BR:pon04090]
 Proteins
  100433126 (FGFR3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig FGFR3_TM V-set C2-set_2 Pkinase_fungal DUF1533
Other DBs
NCBI-GeneID: 100433126
NCBI-ProteinID: XP_024102130
LinkDB
Position
4
AA seq 806 aa
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVLGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRXPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAVGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSC
SSSGDDSVFAHDLLPPAPPSSGGSRT
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgggcgcccctgcctgcgccctcgcgctctgcgtggccgtggccatcgtggccggcgcc
tcctcggagtccttggggacggagcagcgcgtcgtggggcgagcggcagaagtcctgggc
ccagagcccggccagcaggagcagttggtcttcggcagcggggatgctgtggagctgagc
tgtcccccgcccgggggtggtcccatggggcccactgtctgggtcaaggatggcacaggg
ctggtgccctcggagcgtgtcctggtggggccccagcggctgcaggtgctgaatgcctcc
cacgaggactccggggcctacagctgccggcagcggctcacgcagcgcgtactgtgccac
ttcagtgtgcgggtgacagacgctccatcctcaggagatgacgaagacggggaggacgag
gctgaggacacaggtgtggacacaggggccccttactggactcggcccgagcggatggac
aagaagctgctggccgtgccggccgccaacaccgtccgcttccgctgcccggccgccggc
aaccccactccctccatctcctggctgaagaatggcaaggagttccgcggcgagcaccgc
atcggaggcatcaagctgcggcaccagcagtggagcctggtcatggaaagcgtggtgccc
tcagaccgcggcaactacacctgcgtagtggagaacaagtttggcagcatccggcagaca
tacacgctggatgtgctggagcgctccccgcaccggcccatcctgcaggcggggctgccg
gccaaccagacggcggtgctgggcagcgatgtggagttccactgcaaggtgtacagtgac
gcacagccccacatccagtggctcaagcacgtggaggtgaacggcagcaaggtgggcccg
gacggcacaccctacgttaccgtgctcaagacggcgggcgctaacaccaccgacaaggag
ctagaggttctgtccttgcacaacgtcacctttgaggacgccggggagtacacctgcctg
gcgggcaattctattgggttttctcatcactctgcgtggctggtggtgctgccagctgag
gaggagctggtggaggctgacgaggcgggcagtgtgtatgcaggcatcctcagctacggg
gtgggcttcttcttgttcatcctggtggtggcggctgtgacgctctgccgcctacgcnag
ccccccaagaaaggcctgggctcccccaccgtgcacaagatctcccgcttcccgctcaag
cgacaggtgtccctggagtccaacgcgtccatgagctccaacacaccgctggtgcgcatc
gcaaggctgtcctcaggggagggccccacgctggccaatgtctccgagcttgagctgcct
gccgaccccaaatgggagctgtctcgggcccggctgaccctgggcaagccccttggggag
ggctgcttcggtcaggtggtcatggcagaggccgtcggcattgacaaggaccgggccgcc
aagcctgtcaccgtagccgtgaagatgctgaaagacgatgccactgacaaggacctgtcg
gacctggtgtctgagatggagatgatgaagatgattggcaaacacaagaacatcatcaac
ctgctgggcgcctgcacgcagggtgggcccctgtacgtgctggtggagtacgcggctaag
ggtaacttgcgggagttcctgcgggcgcggcggcccccgggcctggactactccttcgac
acctgcaagccacccgaggagcagctcaccttcaaggacctggtgtcctgtgcctaccag
gtggcccggggcatggagtacctggcctcccagaagtgcatccacagggacctggctgcc
cgcaatgtgctggtgaccgaggacaatgtgatgaagatcgcagacttcgggctggcccgg
gacgtgcacaacctcgactactacaagaagacaaccaacggccggctgcccgtgaagtgg
atggcgcctgaggccttgtttgaccgagtctacactcaccagagtgacgtctggtccttt
ggggtcctgctctgggagatcttcacgctagggggctccccgtaccccggtatccctgtg
gaggagctcttcaagctgctgaaggagggacaccgcatggacaagcccgccaactgcaca
cacgacctgtacatgatcatgcgggagtgctggcatgctgcaccctcccagaggcccacc
ttcaagcagctggtggaggacctggaccgtgtccttaccgtgacatccaccgatgagtac
ctggacctgtcggcgcctttcgagcagtactctcctggtggccaggacacccccagctgc
agctcctcaggggatgactccgtgtttgcccacgacctgctgcccccggccccacccagc
agtgggggctcgcggacgtga

DBGET integrated database retrieval system