KEGG   Pongo abelii (Sumatran orangutan): 100433164
Entry
100433164         CDS       T01416                                 

Gene name
SLC7A2
Definition
(RefSeq) cationic amino acid transporter 2
  KO
K13864  solute carrier family 7 (cationic amino acid transporter), member 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100433164 (SLC7A2)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100433164 (SLC7A2)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Other DBs
NCBI-GeneID: 100433164
NCBI-ProteinID: XP_009241836
Ensembl: ENSPPYG00000018389
LinkDB
Position
8
AA seq 658 aa
MIPCRAALTFARCLIRRKIVTLDNLEDTKLCRCLSTMDLIALGVGSTLGAGVYVLAGEVA
KADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLI
LSYVIGTSSVARAWSGTFDELLSKQIGQFLRTYFRMNYTGLAEYPDFFAVCLILLLAGLL
SFGVKESAWVNKVFTAVNILVLLFVMVAGFVKGNVANWKISEEFLKNISASARELSSENG
TSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCF
MAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVGWGPAKYVVAAGSLCALSTSLLGSIFPM
PRVIYAMAEDGLLFKCLAQINSKTKTPIIATLSSGAVAALMAFLFDLKALVDMMSIGTLM
AYSLVAACVLILRYQPGLSYDQPKCSPEKDGLGSSPRATSKSESQVTMLQRQGVSVRTLF
CPSLLPTQQSASLVSFLVGFLAFLVLGLSVLTTYGVHAITRLEAWSLALLALFLVLCVAI
VLTIWRQPQNQQKVAFMVPFLPFLPAFSILVNIYLMVQLSADTWVRFSIWMAIGFLIYFS
YGIRHSLEGHLRDENNEEDAYPDNVHAATEEKSAIQANDHHPRNLSSPFIFHEKTSEF
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgattccctgcagagccgcgctgacctttgcccgatgtctgatccggagaaaaatcgtg
accctggacaatctagaagacaccaaattatgccgctgcttatccaccatggacctcatc
gccctgggtgttggaagcacccttggtgccggggtttacgtcctcgctggggaggtggcc
aaggcagactcgggtcccagcatcgtggtgtccttcctcattgctgctctggcttcagtg
atggctggcctctgctatgccgaatttggggcccgtgtccccaagacggggtctgcgtat
ttgtacacctacgtgactgtcggagagctatgggccttcatcactggctggaatctcatt
ttatcgtatgtgataggtacatcaagtgttgcaagagcctggagtggcacctttgatgaa
cttcttagcaaacagattggtcagtttttgaggacatacttcagaatgaattacactggt
cttgcagaatatcccgatttttttgctgtgtgccttatattacttctagcaggtcttttg
tcttttggagtaaaagagtctgcttgggtgaataaagtcttcacagctgttaatattctc
gtccttttgtttgtgatggttgctgggtttgtgaaaggaaatgtggcaaactggaagatt
agtgaagagtttctcaaaaatatatcagcaagtgccagagagctatcttctgaaaacgga
acaagtatctatggggctggtggctttatgccttatggctttacaggaacgttggctggt
gctgcaacttgcttttatgcctttgtgggatttgactgcattgcaacaactggtgaagaa
gttcggaatccccagaaagctattcccattggaattgtgacgtctttgcttgtttgcttt
atggcctattttggggtctctgcagctttaacacttatgatgccatactacctcctcgat
gaaaaaagcccccttcctgtagcatttgaatatgtgggatggggtcctgccaagtatgtc
gtcgcagctggttctctctgcgccttgtcaacaagtcttcttggatccattttcccaatg
cctcgtgtaatctatgctatggcggaggatgggttgcttttcaaatgtctagctcaaatc
aattccaaaacgaagacaccaataattgctactttatcatcgggtgcagtggcagctttg
atggcctttctgtttgacctgaaggcactcgtggacatgatgtccattggcacactcatg
gcctattctctggtggcagcctgtgttctcatcctcaggtaccagcctggcttatcttac
gaccagcccaaatgttctcccgagaaagatggtctgggatcgtctcccagggcaacctcg
aagagtgagtcccaggtcaccatgctgcagagacagggcgtcagtgtgcggaccctcttc
tgcccctcccttctgccgacacagcagtcagcttccctcgtgagctttctggtaggattc
ctggctttcctcgtgttgggcctgagtgtcttgaccacttacggagttcacgccatcacc
aggctggaggcctggagcctcgctctcctcgcgctgtttcttgttctctgtgttgccatt
gttctcaccatctggaggcagccccagaatcagcaaaaagtggccttcatggttccattc
ttaccatttttgccagcgttcagcatcctggtgaacatttacttgatggtccagttgagt
gcagacacttgggtcagattcagcatttggatggcaattggcttcctgatttacttttct
tatggcatcagacacagcctggagggtcatctgagagatgaaaacaatgaagaagatgct
tatccagacaacgttcatgcagcaacagaagaaaaatctgccattcaagcaaatgaccat
cacccaagaaatctcagttcacctttcatattccatgaaaagacaagtgaattctaa

DBGET integrated database retrieval system