KEGG   Pongo abelii (Sumatran orangutan): 100433183Help
Entry
100433183         CDS       T01416                                 

Gene name
HKDC1
Definition
(RefSeq) putative hexokinase HKDC1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00051  Fructose and mannose metabolism
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon00520  Amino sugar and nucleotide sugar metabolism
pon00524  Neomycin, kanamycin and gentamicin biosynthesis
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon04066  HIF-1 signaling pathway
pon04910  Insulin signaling pathway
pon04930  Type II diabetes mellitus
pon04973  Carbohydrate digestion and absorption
pon05230  Central carbon metabolism in cancer
Module
pon_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pon_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100433183 (HKDC1)
   00051 Fructose and mannose metabolism
    100433183 (HKDC1)
   00052 Galactose metabolism
    100433183 (HKDC1)
   00500 Starch and sucrose metabolism
    100433183 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    100433183 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100433183 (HKDC1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100433183 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100433183 (HKDC1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100433183 (HKDC1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100433183 (HKDC1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100433183 (HKDC1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100433183 (HKDC1)
Membrane trafficking [BR:pon04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100433183 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100433183
NCBI-ProteinID: XP_024109478
Ensembl: ENSPPYG00000002384
LinkDB All DBs
Position
10
AA seq 916 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTCLRENKKVERLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLT
REQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMLEGDEGKMCINTEWGGFGDNGCIDDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQEN
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtccacttgatggcattttacttcagcaagctgaaggaggatcagatcaag
aaggtggacaggttcctgtatcacatgcggctctccgatgacacccttttggacatcatg
aggcggttccgggctgagatggagaagggcctggcaaaggacaccaaccccacggctgca
gtgaagatgctgcccaccttcgtcagggccattcccgatggttccgaaaatggggagttc
ctttccctggatctcggagggtccaagttccgagtgctgaaggtgcaagtcgctgaagag
gggaagcgacacgtgcagatggagagtcagttctacccaacgcccaatgaaatcatccgc
gggaacggcacagagctgtttgaatatgtagctgactgtctggcagatttcatgaagacc
aaagatttaaagcataagaaattgccccttggcctaactttttctttcccctgtcgacag
actaaactggaagagggtgttctgctttcatggacaaaaaagtttaaggcacgaggagtt
caggacacggatgtggtgagccgtctgaccaaagccatgagaagacacaaggacatggat
gtggacatcctggccctggtcaatgacaccgtggggaccatgatgacctgtgcctatgac
gacccctactgcgaagttggtgtcatcatcggaactggcaccaatgcgtgttacatggag
gacatgagcaacattgacctggtggagggcgacgagggcaggatgtgcatcaacacagag
tggggggccttcggggacgacggggccctggaggacattcgcactgagttcgacagggag
ctggacctcggctctctcaacccgggaaagcaactgtttgagaagatgatcagtggcctg
tacctgggggagcttgtcaggcttatcttgctgaagatggccaaggctggcctcctgttc
ggcggtgagaaatcttctgctctccacactaagggcaagatcgaaacacggcacgtggct
gccatggagaagtataaagaaggccttgctaatacaagagagatcctggtggacctgggt
ctggaaccgtctgaggctgactgcattgccgtccagcatgtctgtaccatcgtctccttc
cgctcggccaatctctgtgcagcagccctggcggccatcctgacatgcctccgggagaac
aagaaggtggaacggctccggaccacggtgggcatggacggcaccctctacaagatacac
cctcagtacccaaaacgcctgcacaaggtggtgaggaaactggtcccaagctgtgatgtc
cgcttcctcctgtcagagagtggcagcaccaagggggccgccatggtgactgcggtggcc
tcccgcgtgcaggcccagcggaagcagatcgacagggtgctggctttgttccagctgacc
cgagagcagcttgtggacgtgcaggccaagatgcgggctgagctggagtatggtctgaag
aagaagagccacgggctggccacggtcaggatgctgcccacctacgtctgtgggctgcca
gacggcacagagaaaggaaagtttctcgccctggatcttgggggaaccaacttccgggtc
ctcctggtgaagatcagaagtggacggaggtcagtgcgaatgtacaacaagatcttcgcc
atccccctggagatcatgcagggcactggtgaggagctctttgatcacattgtgcagtgc
atcgccgacttcctggactacatgggcctcaagggagcctccctacctttgggattcaca
ttctcatttccctgcaggcagatgagcattgacaagggaacactcatagggtggaccaaa
ggtttcaaggccactgactgtgaaggggaggacgtggtggacatgctcagggaagccatc
aagaggagaaacgagtttgacctggacattgttgcagtcgtgaatgatacagtggggacc
atgatgacctgtggctatgaagatcctaattgtgagattggcctgattgcaggaacaggc
agcaacatgtgctacatggaggacatgaggaacatcgagatgctggagggggatgaaggg
aagatgtgcatcaacacagagtggggaggatttggagacaatggctgcatagatgacatc
cggacccgatacgacacagaggtggatgaggggtccttgaatcctggcaagcagagatac
gagaaaatgaccagtgggatgtacttgggggagattgtgcggcagatcctgatcgacctg
accaagcagggtctcctcttccgagggcagatttcagagcgtctccggaccaggggcatc
ttcgaaaccaagttcctgtcccagattgaaagcgatcggctggccctcctccaggtcagg
aggattctgcagcagctgggcctggacagcacatgtgaggacagcatcgtggtgaaggag
gtgtgcggagccgtgtcccggcgggcggcccagctctgcggtgctggcctggccgctata
gtggaaaaaaggagagaagaccaggggctggagcacctgaggatcactgtgggtgtggac
ggcaccctgtacaagctgcaccctcacttttctagaatattgcaggaaactgtgaaggaa
ctagcccctcgatgtgatgtgacattcatgctgtcagaagatggcagtggaaaaggggca
gcactgatcactgctgtggccaagaggttacagcaggcacaggagaactag

DBGET integrated database retrieval system