KEGG   Pongo abelii (Sumatran orangutan): 100433208
Entry
100433208         CDS       T01416                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04218  Cellular senescence
pon04350  TGF-beta signaling pathway
pon04390  Hippo signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05220  Chronic myeloid leukemia
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100433208 (TGFB3)
   04350 TGF-beta signaling pathway
    100433208 (TGFB3)
   04390 Hippo signaling pathway
    100433208 (TGFB3)
   04068 FoxO signaling pathway
    100433208 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100433208 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100433208 (TGFB3)
   04218 Cellular senescence
    100433208 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433208 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100433208 (TGFB3)
   05212 Pancreatic cancer
    100433208 (TGFB3)
   05225 Hepatocellular carcinoma
    100433208 (TGFB3)
   05226 Gastric cancer
    100433208 (TGFB3)
   05220 Chronic myeloid leukemia
    100433208 (TGFB3)
   05211 Renal cell carcinoma
    100433208 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100433208 (TGFB3)
   05321 Inflammatory bowel disease
    100433208 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100433208 (TGFB3)
   05414 Dilated cardiomyopathy
    100433208 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100433208 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100433208 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100433208 (TGFB3)
   05161 Hepatitis B
    100433208 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100433208 (TGFB3)
   05144 Malaria
    100433208 (TGFB3)
   05145 Toxoplasmosis
    100433208 (TGFB3)
   05140 Leishmaniasis
    100433208 (TGFB3)
   05142 Chagas disease
    100433208 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100433208 (TGFB3)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100433208 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100433208
NCBI-ProteinID: XP_002825003
Ensembl: ENSPPYG00000006009
UniProt: H2NLV1 A0A6D2YA46
LinkDB
Position
14
AA seq 412 aa
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcacgagcccccctgagccaacg
gtgatgacccacgtcccctatcaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcatggggagagggaggaaggctgcacccaggaaaacaccgagtcggaatac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaacgaactg
gctgtctgccccaaaggaattacctccaaggttttccgcttcaatgtgtcctcagtggag
aaaaatagaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcggaatgagcagaggatcgagctctttcagatccttcggccagatgagcacatt
gccaaacagcgctatatcggtggcaagaatctgcccacacggggcactgccgagtggctg
tccttcgatgtcactgacactgtgcgtgagtggctgttgagaagagagtccaacttaggt
ctagaaatcagcattcactgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcacgaggtgatggaaatcaaattcaaaggcgtggacaatgaggatgaccatggc
cgtggagatctggggcgcctcaagaagcagaaggatcaccacaaccctcatctaatcctc
atgatgattcccccacaccggctcgacaacccgggccaagggggtcagaggaagaagcgg
gccttggacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccccctc
tacattgacttccgacaggatctgggctggaagtgggtccatgaacctaagggctactat
gccaacttctgctcaggcccttgcccatacctccgcagtgcagacacaacccacagcacg
gtgctgggactgtacaacactctgaaccctgaagcatctgcctcgccttgctgcgtgccc
caggacctggagcccctgaccatcctgtactatgttgggaggacccccaaggtggagcag
ctctccaacatggtggtgaagtcttgtaaatgtagctga

KEGG   Pongo abelii (Sumatran orangutan): 100459982
Entry
100459982         CDS       T01416                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04218  Cellular senescence
pon04350  TGF-beta signaling pathway
pon04380  Osteoclast differentiation
pon04390  Hippo signaling pathway
pon04659  Th17 cell differentiation
pon04672  Intestinal immune network for IgA production
pon04926  Relaxin signaling pathway
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05220  Chronic myeloid leukemia
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459982 (TGFB1)
   04350 TGF-beta signaling pathway
    100459982 (TGFB1)
   04390 Hippo signaling pathway
    100459982 (TGFB1)
   04068 FoxO signaling pathway
    100459982 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100459982 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100459982 (TGFB1)
   04218 Cellular senescence
    100459982 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100459982 (TGFB1)
   04672 Intestinal immune network for IgA production
    100459982 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100459982 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100459982 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459982 (TGFB1)
   05205 Proteoglycans in cancer
    100459982 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100459982 (TGFB1)
   05212 Pancreatic cancer
    100459982 (TGFB1)
   05225 Hepatocellular carcinoma
    100459982 (TGFB1)
   05226 Gastric cancer
    100459982 (TGFB1)
   05220 Chronic myeloid leukemia
    100459982 (TGFB1)
   05211 Renal cell carcinoma
    100459982 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100459982 (TGFB1)
   05321 Inflammatory bowel disease
    100459982 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100459982 (TGFB1)
   05414 Dilated cardiomyopathy
    100459982 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100459982 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100459982 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100459982 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100459982 (TGFB1)
   05161 Hepatitis B
    100459982 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100459982 (TGFB1)
   05144 Malaria
    100459982 (TGFB1)
   05145 Toxoplasmosis
    100459982 (TGFB1)
   05140 Leishmaniasis
    100459982 (TGFB1)
   05142 Chagas disease
    100459982 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100459982 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459982 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100459982 (TGFB1)
Chaperones and folding catalysts [BR:pon03110]
 Intramolecular chaperones
  Others
   100459982 (TGFB1)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100459982 (TGFB1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100459982 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100459982
NCBI-ProteinID: XP_009230906
Ensembl: ENSPPYG00000010013
LinkDB
Position
19
AA seq 390 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSKDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggta
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcgcaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctc
tacaacagcacccgcgaccgggtggccggggagagtgcagagccggagcccgagcctgag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagtacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcagtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccggctgctggcacccagcgactcgccggagtggttgtcttttgatgtc
accggagttgtgcggcagtggttgagccgcggaggggaaattgagggctttcgccttagt
gcccactgctcctgtgacagcaaagataacacactgcaagtggacatcaacgggttcact
accggccgccgaggtgacctggccaccattcacggcatgaaccggcctttcctgcttctc
atggccaccccactggagagggcccagcatctgcaaagctcccggcaccgccgagccctg
gacaccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctgtacatt
gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccatgctaac
ttctgcctcgggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaaacccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Pongo abelii (Sumatran orangutan): 100461291
Entry
100461291         CDS       T01416                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04218  Cellular senescence
pon04350  TGF-beta signaling pathway
pon04380  Osteoclast differentiation
pon04390  Hippo signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05220  Chronic myeloid leukemia
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100461291 (TGFB2)
   04350 TGF-beta signaling pathway
    100461291 (TGFB2)
   04390 Hippo signaling pathway
    100461291 (TGFB2)
   04068 FoxO signaling pathway
    100461291 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100461291 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100461291 (TGFB2)
   04218 Cellular senescence
    100461291 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100461291 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461291 (TGFB2)
   05206 MicroRNAs in cancer
    100461291 (TGFB2)
   05205 Proteoglycans in cancer
    100461291 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100461291 (TGFB2)
   05212 Pancreatic cancer
    100461291 (TGFB2)
   05225 Hepatocellular carcinoma
    100461291 (TGFB2)
   05226 Gastric cancer
    100461291 (TGFB2)
   05220 Chronic myeloid leukemia
    100461291 (TGFB2)
   05211 Renal cell carcinoma
    100461291 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100461291 (TGFB2)
   05321 Inflammatory bowel disease
    100461291 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100461291 (TGFB2)
   05414 Dilated cardiomyopathy
    100461291 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100461291 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100461291 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100461291 (TGFB2)
   05161 Hepatitis B
    100461291 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100461291 (TGFB2)
   05144 Malaria
    100461291 (TGFB2)
   05145 Toxoplasmosis
    100461291 (TGFB2)
   05140 Leishmaniasis
    100461291 (TGFB2)
   05142 Chagas disease
    100461291 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100461291 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100461291 (TGFB2)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100461291 (TGFB2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100461291 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 100461291
NCBI-ProteinID: XP_002809490
Ensembl: ENSPPYG00000000213
UniProt: A0A2J8RS20
LinkDB
Position
1
AA seq 442 aa
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLNSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaacagtcccccagaagactatcctgagcct
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaagagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccttacttcagaattgttcgattt
gacgtctcagcaatggagaagaatgcttccaatttggtgaaagcagagttcagagtcttt
cgtttgcagaacccaaaagccagagtgcctgaacaacggattgagctgtatcagattctc
aagtccaaagatttaacatctccaacccagcgctacattgacagcaaagttgtgaaaaca
agagcagaaggcgaatggctctccttcgatgtaactgatgctgttcatgaatggcttcac
cataaagacaggaacctgggatttaaaataagcttacactgtccctgctgcacttttgta
ccatctaataattacatcatcccaaataaaagcgaagaactagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttattgccctcctacagacttgag
tcacaacagaccaaccggcggaagaagcgtgctttggatgcggcctattgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatctagggtgg
aaatggatacacgaacccaaagggtacaatgccaacttctgtgctggagcatgcccgtat
ttatggagttcagacactcagcacagcagggtcctgagcttatataataccataaatcca
gaagcatctgcttctccttgctgcgtgtcccaagatttagaacctctaaccattctctac
tacattggaaaaacacccaagattgaacagctttctaatatgattgtaaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system