KEGG   Pongo abelii (Sumatran orangutan): 100433386
Entry
100433386         CDS       T01416                                 

Gene name
CSF1R
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04151  PI3K-Akt signaling pathway
pon04380  Osteoclast differentiation
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100433386 (CSF1R)
   04014 Ras signaling pathway
    100433386 (CSF1R)
   04015 Rap1 signaling pathway
    100433386 (CSF1R)
   04151 PI3K-Akt signaling pathway
    100433386 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100433386 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100433386 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100433386 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100433386 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433386 (CSF1R)
   05202 Transcriptional misregulation in cancer
    100433386 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100433386 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100433386 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100433386 (CSF1R)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100433386 (CSF1R)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100433386 (CSF1R)
CD molecules [BR:pon04090]
 Proteins
  100433386 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 Izumo-Ig Serglycin C2-set_2 AF-4
Other DBs
NCBI-GeneID: 100433386
NCBI-ProteinID: XP_024103185
Ensembl: ENSPPYG00000015942
LinkDB
Position
5
AA seq 983 aa
MGPGVLLLLLVATAWHGQGIPVIEPSGPELVVKPGAMVTLRCVGNGSVEWDGSVEWDGPV
SPHWTLHSDGSSSVLTNNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQE
VVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQD
YQCSALMGGRKVMSISIRLKVQKVIPGPPALTLAPAELVRIRGEAAQIVCSASNVDVNFD
VFLQHNDTKLTIPQQSDFHNNRYQKVLTFNLDQVDFQHAGNYSCVANNVQGKHSTSMFFR
VVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANA
TIKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGS
GTLVCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTV
ETLEHNQTYECRAHNSVGSGSWAFIPISAGARTHPPDEFLFTPVVVACMSIMALLLLLLL
LLLYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFG
KVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACT
HGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPKGGVDYKNIHLEKKYVHRDSG
FSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELWDLLHFSSQVAQGMAFLASKNC
IHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCIYTV
QSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWA
LEPTHRPTFQQICSFLQEQAQEDRRQQDYTNLPSSSRSGGSGSGSGSGSSSELEEESASE
HLTCCEQGDIAQPLLQPNNYQFC
NT seq 2952 nt   +upstreamnt  +downstreamnt
atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatc
ccagtgatagagcccagtggccctgagctggtcgtgaagccaggagcaatggtgaccctg
cgatgtgtgggcaatggcagcgtggaatgggatggcagcgtggaatgggatggccccgta
tcacctcactggaccctgcactctgatggctccagcagcgtcctcaccaacaacaacgct
accttccaaaacacggggacctatcgctgcactgagcctggagaccccctgggaggcagt
gctgccatccacctctatgtcaaagaccctgcccggccctggaacgtgctagcacaggag
gtggtcgtgttcgaggaccaggacgcactgctgccctgtctgctcacagacccggtgctg
gaagcaggcgtctcgctggtgcgtgtgcgtggccggcccctcatgcgccacaccaactac
tccttctcgccttggcatggcttcaccatccacagggccaagttcattcagagccaggac
tatcaatgcagtgccctgatgggtggcaggaaggtgatgtccatcagcatccggctgaaa
gtgcagaaagtcatcccagggcccccagccttgacactggcgcctgcagagctggtgcgg
attcgaggggaggctgcccagatcgtgtgctcagccagcaacgttgatgttaactttgat
gtcttcctccaacacaacgacactaagctcacaatccctcaacaatctgactttcataat
aaccgttaccaaaaagtcctgaccttcaacctcgatcaagtagatttccaacatgccggc
aactactcctgcgtggccaacaatgtgcagggcaagcactccacctccatgttcttccgg
gtggtagagagtgcctacttgaacttgagctctgagcagaacctcatccaggaggtgacc
gtgggggaggggctcaacctcaaagtcatggtggaggcctacccaggcctgcaaggtttt
aactggacctacctgggacccttttctgaccaccagcctgagcccaagcttgctaatgct
accatcaaggacacatacaggcacaccttcaccctctctctgccccgcctgaagccctct
gaggctggccgctactccttcctagccagaaacccaggaggctggagagctctgacgttt
gagctcacccttcgataccccccagaggtaagtgtcatatggaccttcatcaatggctct
ggcacccttgtgtgtgctgcctccgggtacccccagcccaacgtgacatggctgcagtgc
agtggccacactgataggtgtgatgaggcccaagtgctgcaggtctgggatgacccatac
cctgaggtcctgagccaggagcccttccacaaggtgaccgtgcaaagcctgctgactgtt
gagaccttagagcacaaccaaacctacgagtgcagggcccacaacagcgtggggagtggc
tcctgggccttcatacccatctctgcaggagcccgcacgcatcccccagatgagttcctc
ttcacaccagtggtggtcgcctgcatgtccatcatggccttactgctgctgctgctcctg
ctgctattgtacaagtataagcagaagcccaagtaccaggtccgctggaagatcatcgag
agctatgagggcaacagttacactttcatcgaccccacacagctgccttacaacgagaag
tgggagttcccccggaacaacctgcagtttggtaagaccctcggagctggcgcctttggg
aaggtggtggaggccacggcctttggtctgggcaaagaggatgctgtcctgaaggtggct
gtgaagatgctgaagtccacggcccatgctgatgagaaggaggccctcatgtccgagctg
aagatcatgagccacctgggccagcacgagaacatcgtcaaccttctgggagcctgcacc
catggaggccctgtactggtcatcacggagtactgttgctatggcgacctgctcaacttt
ctgcgaaggaaggctgaggccatgctgggacccagcctgagccccggccaggaccccaag
ggaggcgtcgactataagaacatccacctcgagaagaaatatgtccacagggacagtggc
ttctccagccagggtgtggacacctatgtggagatgaggcctgtctccacttcttcaaat
gactccttctctgagcaagacctggacaaggaggatggacggcccctggagctctgggac
ctgcttcacttctccagccaagtagcccagggcatggccttcctcgcttctaagaattgc
atccaccgggatgtggcagcacgtaacgtgctgttgaccaatggtcatgtggccaagatt
ggggacttcgggctggctagggacatcatgaatgactccaactacatcgtcaagggcaat
gcccgcctgcctgtgaagtggatggccccagagagcatctttgactgtatctacacggtt
cagagcgacgtctggtcctatggcatcctcctctgggagatcttctcgcttgggctgaat
ccctaccctggcatcctggtgaacagcaagttctataaactggtgaaggatggataccaa
atggcccagcctgcatttgccccaaagaatatatacagcatcatgcaggcctgctgggcc
ttggagcccacccacagacccaccttccagcagatctgctccttccttcaggagcaggcc
caagaggacaggagacagcaggactataccaatctgccgagcagcagcagaagcggtggc
agcggcagcggcagcggcagcggcagcagcagtgaactggaggaggagagcgctagtgag
cacctgacctgctgcgagcaaggggatatcgcccagcccttgctgcagcccaacaactat
cagttctgctga

DBGET integrated database retrieval system