KEGG   Pongo abelii (Sumatran orangutan): 100433477
Entry
100433477         CDS       T01416                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1 isoform X1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04621  NOD-like receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05140  Leishmaniasis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05212  Pancreatic cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100433477 (JAK1)
   04151 PI3K-Akt signaling pathway
    100433477 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100433477 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100433477 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100433477 (JAK1)
   04658 Th1 and Th2 cell differentiation
    100433477 (JAK1)
   04659 Th17 cell differentiation
    100433477 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100433477 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433477 (JAK1)
   05203 Viral carcinogenesis
    100433477 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100433477 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100433477 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100433477 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100433477 (JAK1)
   05161 Hepatitis B
    100433477 (JAK1)
   05160 Hepatitis C
    100433477 (JAK1)
   05171 Coronavirus disease - COVID-19
    100433477 (JAK1)
   05164 Influenza A
    100433477 (JAK1)
   05162 Measles
    100433477 (JAK1)
   05168 Herpes simplex virus 1 infection
    100433477 (JAK1)
   05163 Human cytomegalovirus infection
    100433477 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100433477 (JAK1)
   05169 Epstein-Barr virus infection
    100433477 (JAK1)
   05165 Human papillomavirus infection
    100433477 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100433477 (JAK1)
   05140 Leishmaniasis
    100433477 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100433477 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100433477 (JAK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100433477 (JAK1)
Protein kinases [BR:pon01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100433477 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 100433477
NCBI-ProteinID: XP_002810775
Ensembl: ENSPPYG00000001270
UniProt: H2N755 A0A6D2XH65
LinkDB
Position
1
AA seq 1154 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDIGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggcccctgagccaggggtggaagtgatcttc
tatctgtcggacagggagcccctccggctgggcagtggagagtacacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctctcctctttgtcacaacctctttgccctg
tatgacgagaacaccaagctctggtatgctccaaatcgcaccatcaccgttgatgacaag
atgtccctccggctccactaccggatgaggttctatttcaccaattggcatggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctacgagaaa
aaaaaggttccagatgcaacccctctccttgatgccagctcactggagtatctgtttgct
cagggacagtatgatttggtgaaatgcctggctcctattcgagaccccaagaccgagcag
gatggacatgatattgagaatgagtgtctagggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgaggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacttggctactttggaaactttgacaaaacat
tacggtgctgaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcattcgaatgacattggaaacgttctgtactacgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaaataaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctctcttcccacgag
gaggccttgtcctttgtgtccctggtagatggctacttccggctcacagcagacgcccat
cattacctctgcaccgacgtggcccccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggtgcagggtgcccagaagcagttcaagaactttcaaatc
gaggtgcagaagggccgctacagtctgcacggttcagaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgcta
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gctcaggagtggcagcctgtctaccccatgagccagctgagtttcgatcggatcctcaag
aaggatctggtgcagggcgagcaccttgggagaggcacaagaacacacatctactctggg
accctgatggattacaaggatgacgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccccagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctacggcgtctgtgtccgcgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagcgatgtccttaccacaccatggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaggataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgaaggcatcgacagtgagtgtggcccgttcatcaagctcagtgaccct
ggcatccccattacggtgctgtctaggcaagagtgcattgaacgaatcccatggattgct
cccgagtgtgttgaggactccaagaacctgagtgtggctgctgacaagtggagctttgga
accacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacgctgatt
gagaaagagagattctatgaaagccggtgcaggccggtgacaccatcgtgtaaggagctg
gctgacctcatgacccgctgcatgaactacgaccccaatcagaggcctttcttccgagct
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaaa
ccagcaactgaagtggaccccacacattttgaaaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgttaagtctctgaagcctgagagtggaggtaaccacatagct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcatgagaacattgtgaagtac
aaaggaatctgcacagaagacggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatacgtt
caccgggacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gactttggtttaaccaaagcaattgaaaccgataaggagtattacaccgtcaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatatt
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgattca
gattctagtcccatggctttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacattaaaagaaggaaaacgcctgccgtgcccacctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system