KEGG   Pongo abelii (Sumatran orangutan): 100433501
Entry
100433501         CDS       T01416                                 

Gene name
ITGA9
Definition
(RefSeq) integrin alpha-9
  KO
K06585  integrin alpha 9
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100433501 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100433501 (ITGA9)
   04514 Cell adhesion molecules
    100433501 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100433501 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100433501 (ITGA9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100433501 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100433501 (ITGA9)
   05414 Dilated cardiomyopathy
    100433501 (ITGA9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100433501 (ITGA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pon04515]
    100433501 (ITGA9)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100433501 (ITGA9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 Integrin_alpha
Other DBs
NCBI-GeneID: 100433501
NCBI-ProteinID: XP_024100906
LinkDB
Position
3
AA seq 1035 aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLSDEVIM
NRRYTYLGYAVTAGHFSHPSTTDVVGGAPQDKGIGKVYIFRADRRSGALIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGRKIN
PVLRMFGQSISGGIDMDGNGYPDVTMGAFMSDSVVLLRARPVITVDVSIFLPGSINITAP
QCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQLPRVYFVLLGETMG
QVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLRGKLLLSSMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
SFVYGESVDTANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgggcggcccggctgcgccgaggggcgccgggaggctccgcgcgctgctgctggcgctg
gtggtcgcgggaatccccgcgggcgcctacaacctcgacccgcagcgccccgtgcacttc
cagggccccgctgactcgtttttcggctacgcagttctggagcatttccacgacaacacg
cgctgggtccttgtgggtgcaccaaaggcagattccaaatacagcccttcagtgaagtct
cctggggctgtgtttaagtgccgtgttcacaccaaccctgaccggagatgcactgaactg
gacatggctcgagggaagaatcggggcacgtcctgcggaaagacctgccgagaagaccgc
gatgatgagtggatgggggtgagcctggcccgacagcccaaggctgatggccgtgtgttg
gcctgtgctcatcgctggaagaacatctactatgaagccgaccacatcctaccccatggc
ttctgctacatcatcccctccaacctccaggccaaaggcaggacgctgatcccttgctat
gaagagtataagaagaagtacggagaggaacacggctcctgccaggctgggatagcgggc
ttcttcaccgaggagctggtggtgatgggtgctccagggtcattttattgggctggaacc
atcaaagtgctgaaccttacggacaacacctatttaaaactgagcgatgaagtaatcatg
aacaggcggtacacctacctgggctacgcagtgaccgctggccacttctctcacccgtcc
accactgatgtggtaggaggtgccccacaggacaaaggcatcggcaaggtttatattttc
agagctgaccgaagatcaggcgccttaattaagatctttcaagcatcaggtaaaaagatg
ggctcttacttcggctcctccttgtgcgcagttgacctgaacggggacggcctctctgac
ctgctggtgggggcccccatgttttctgagatcagggacgagggacaggtcactgtctac
atcaacagaggaaatggagccctcgaggagcagctggctctgactggggatggcgcctac
aatgcgcactttggagagagcattgccagcctggacgatctggacaatgatgggttccca
gatgtggccattggcgcacccaaggaggacgacttcgcaggggcggtctatatctatcat
ggtgatgccggtgggatagtccctcagtactcaatgaaactgtccgggcggaagataaat
ccagtgctccggatgtttggtcagtccatatcgggaggcattgatatggatggaaatggc
tatcctgatgtcaccatgggagccttcatgtccgacagcgtggttcttctcagagcaagg
cctgtcattacggtggatgtgtccatattcctcccgggctccatcaacatcacggcgcct
cagtgtcacgacggacagcagcctgtgaactgcctgaatgtcaccacctgcttcagcttc
catggcaaacacgttccaggagagattggcctgaattatgttctgatggctgacgtggcc
aaaaaggagaagggccagctgcccagggtctactttgtgctgctgggagagaccatgggt
caggtcacagagaagctgcagctgacttacatggaggagacgtgtcgtcactacgtggcc
catgtgaagcggagggtgcaggacgtcatcagcccgatcgtgtttgaagcagcctacagc
ctcagtgagcatgtaactggagaggaggagagggaactgccgcctctgacaccagttctc
cgctggaaaaagggacaaaagattgcccaaaagaatcagactgtttttgaaaggaattgc
cgttcagaggactgtgccgcggacctgcagcttcggggtaaactgctgctttctagtatg
gatgagaaaaccctgtatctagctttgggggctgtgaagaacatctccctaaacatctct
atctccaacctcggggatgatgcctatgatgccaacgtgtccttcaatgtttcacgggag
ctcttcttcatcaacatgtggcagaaggaggagatgggcatctcctgtgagctgttggaa
tcggacttcctcaaatgcagcgtgggatttcctttcatgaggtcaaagtcaaagtatgaa
ttcagcgtgatctttgatacaagccacctgtctggggaagaggaagttctcagcttcatt
gttactgctcagagtggcaacacggagcgctctgaatccctgcatgacaacaccctcgtg
ctgatggtgccgctgatgcacgaggtggacacgtccatcaccggaatcatgtctccaacc
tcctttgtatatggcgagtccgtggacacagccaacttcattcagctggatgacctggag
tgtcactttcagcccatcaatatcacccttcaggtctacaacactggcccaagcaccctt
ccagggtcatctgtcagcatctctttccctaatcgactctcatctggtggtgcagagatg
tttcacgtccaggaaatggtggtgggccaagagaagggaaactgctctttccagaaaaac
ccaactccctgcatcatccctcaagaacaagaaaatatcttccacacaatatttgctttt
ttcacaaagtctggaagaaaagtcttggactgtgaaaaaccaggaatttcttgcctaaca
gcacactgtaactttagtgctcttgctaaagaagaaagtcgtactatagacatttacatg
ctgctgaacacagaaatactgaaaaaggacagttcgtctgtcatccagttcatgtcccgc
gccaaggtgaaggtggatcctgccctaagggtggtggaaatagctcatgggaacccagaa
gaggtgacggtggtcttcgaggccctgcacaatctggagccccgtggctacgtcgtgggg
tggatcatcgccatcagtttgttggtgggaatcctcatcttcctgctgctggccgtgctg
ctctggaagatgggcttctttcgccgaaggtacaaagaaattatcgaagctgagaagaac
cggaaagagaatgaagacagttgggactgggtccagaaaaaccagtga

KEGG   Pongo abelii (Sumatran orangutan): 100439453
Entry
100439453         CDS       T01416                                 

Gene name
ITGA1
Definition
(RefSeq) integrin alpha-1
  KO
K06480  integrin alpha 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100439453 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100439453 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100439453 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100439453 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100439453 (ITGA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100439453 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100439453 (ITGA1)
   05414 Dilated cardiomyopathy
    100439453 (ITGA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100439453 (ITGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100439453 (ITGA1)
   04515 Cell adhesion molecules [BR:pon04515]
    100439453 (ITGA1)
   04090 CD molecules [BR:pon04090]
    100439453 (ITGA1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100439453 (ITGA1)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100439453 (ITGA1)
CD molecules [BR:pon04090]
 Proteins
  100439453 (ITGA1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 HisK_sensor LYRIC Integrin_alpha VWA_CoxE Cation_ATPase_N
Other DBs
NCBI-GeneID: 100439453
NCBI-ProteinID: XP_002815595
Ensembl: ENSPPYG00000015450
UniProt: A0A6D2XK31 H2PFI5
LinkDB
Position
5
AA seq 1179 aa
MTPRLRARPGVAVACCWLLTVVLHSCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPSVGQPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVRECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEEE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKAGQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTIDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPIKQTCCSSRQHNSCTKENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVT
FKILFQFNTSYLLENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
VSIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLHPT
GLSSSDNANCRPHIFEDPFSINSGKKMTTSTDQLKRGTILDCNTCKFATITCNLTPSDIS
QVNVSLILWKPTFIKSYFSSLNLTIRGELRSENTSLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgacccctcggctccgcgcccgcccaggggtcgctgtcgcctgctgctggctcctcact
gttgttctacacagctgcgtatcattcaatgttgatgtgaaaaattcaatgactttcagc
ggcccagtggaagacatgtttggatatactgttcaacaatatgaaaatgaagaaggaaaa
tgggtgcttattggttctccttcagttggccaacccaaaaacagaactggagatgtctat
aagtgtccagttgggagaggtgaatcattaccttgtgtaaagttggatctaccagttaat
acatcaattcccaatgtcacagaagtaaaggagaacatgacatttggatcaactttagtc
accaacccaaacggaggatttctggcatgtgggcccttatatgcctatagatgtggacat
ttgcattacacaactggaatctgttctgacgtcagccctacatttcaagtcgtgaattcc
attgcccctgtacgagaatgcagcactcaactggacatagtcatagtgctggatggttcc
aacagtatttacccatgggacagtgttacagcttttttaaatgaccttcttgaaagaatg
gatattggtcctaaacagacacaggttggaattgtacagtacggagaaaatgtgacccat
gagttcaacctcaataagtattcttccaccgaagaggtacttgttgcagcaaagaaaata
gtccagagaggtggccgccagactatgacagctcttggaatagacacagcaagaaaggag
gcattcacggaagcccggggtgcccgaagaggagttaaaaaagtcatggttattgtgacg
gatggagagtctcatgacaaccatcgactgaagaaggtcatccaagactgtgaagaagaa
aacattcaacgattttccatagctattcttggcagctataaccgaggaaatttaagcact
gagaaatttgtggaggaaataaaatcaattgcaagtgaacccactgaaaagcatttcttc
aacgtctctgatgaattggctctagtcaccattgttaaaactctgggagaaagaatattt
gccctggaagctacagctgaccagtcagcagcttcatttgaaatggaaatgtctcagact
ggcttcagtgctcattattcacaggattgggtcatgcttggagcagtaggagcctatgat
tggaatggaacagttgtcatgcagaaggctggtcaaatcataatccctcgaaacacaacc
tttaatgttgagtctaccaaaaagaatgaaccgcttgcttcttatttaggttacactgta
aactctgctactgcttcttctggagatgtgctctatattgctggacagcctcggtacaat
catacaggccaggtcattatctacaggatggaagatggaaacatcaaaattctccagaca
ctcagtggagaacagattggttcctactttggcagcattttaacaacaattgacattgac
aaggattctaatactgacattcttctagtcggagcccctatgtacatgggaacagagaag
gaggagcagggaaaagtgtatgtgtatgctctcaatcagacaaggtttgaatatcaaatg
agcctggaacctattaagcagacgtgctgttcatctcggcagcacaattcatgcacaaaa
gaaaacaaaaatgagccatgcggggctcgttttggaactgcaattgctgctgtaaaagac
ctcaatcttgatggatttaatgacatcgtgataggagctccgctggaagatgatcacggg
ggagctgtgtacatttatcatggaagtggcaagactataaggaaagagtatgcacaacgt
attccatcaggtggggatggtgagacactgaaattttttggccagtctatccacggagaa
atggatttaaatggcgacggtctgacagatgtgactattgggggccttggtggtgctgcc
ctcttctggtcccgagatgtggccgtagttaaagtgaccatgaattttgagccaaataaa
gtgaatatacaaaagaaaaactgccatatggagggaaaagaaacagtatgcataaatgct
acagtgtgttttgatgtgaaattaaaatctaaagaagacacgatttatgaagctgatttg
cagtaccgtgtcaccctagattcactaagacaaatatcacggagttttttctctggaact
caagagagaaaggttcaaaggaacatcacagttcgaaaatcagaatgcactaagcactcc
ttctacatgttggacaaacatgactttcaggactctgtgagaataacgttggactttaat
cttacggatccagaaaatgggcctgttcttgatgattctctaccaaactcagtacatgaa
tatattccctttgccaaagattgtggaaacaaggaaaaatgtatctcggacctcagcctg
catgtcgccaccactgaaaaggacctgctgattgtccggtcccagaatgataagttcaac
gttagcctcacagtaaaaaatacaaaggacagtgcctataacaccaggacaatagtgcat
tattctccaaatctagttttttcaggaattgaggctatccaaaaagacagttgtgaatcc
aatcataatatcacatgtaaagttggatatcccttcctgagaagaggagagatggtaact
ttcaaaatattgtttcagtttaacacatcctatctcctggaaaatgtgaccatttattta
agtgcaacaagtgacagcgaagaacctcctgaaaccctttctgataatgtagtaaacatt
tctatcccggtaaaatatgaagttggactacagttttacagctctgcaagtgaataccac
gtttcaattgctgccaatgagacagtccctgaagttattaattctactgaggacattgga
aatgaaattaatatcttctacttgattagaaaaagtggatcttttccaatgccagaactt
aagctgtcaatttcattccccaatatgacatcaaatggttatcctgtgctgcacccaact
ggattgtcatcttctgataatgcaaactgcagaccccatatctttgaggatcctttcagt
atcaactctggaaagaaaatgactacatcaactgaccagctcaaacgaggcacaattctg
gactgcaatacatgtaagtttgctaccatcacatgtaatctcactccttctgacatcagc
caagtgaatgtttcacttatcttgtggaaaccaacttttataaaatcatatttttccagc
ttaaatcttactataaggggagaacttcggagtgaaaatacatctttggttttaagtagc
agcaatcaaaaaagagagcttgctattcaaatatccaaagatgggctaccgggcagagtg
ccattatgggtcatcctgctgagtgcttttgccggattgttgctgttaatgctgctcatt
ttagcactgtggaagattggattcttcaaaagaccattgaaaaagaaaatggagaaatga

KEGG   Pongo abelii (Sumatran orangutan): 100439761
Entry
100439761         CDS       T01416                                 

Gene name
ITGA7
Definition
(RefSeq) integrin alpha-7 isoform X1
  KO
K06583  integrin alpha 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100439761 (ITGA7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100439761 (ITGA7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100439761 (ITGA7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100439761 (ITGA7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100439761 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100439761 (ITGA7)
   05414 Dilated cardiomyopathy
    100439761 (ITGA7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100439761 (ITGA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100439761 (ITGA7)
   04515 Cell adhesion molecules [BR:pon04515]
    100439761 (ITGA7)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100439761 (ITGA7)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100439761 (ITGA7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF3488 LYRIC DUF2207
Other DBs
NCBI-GeneID: 100439761
NCBI-ProteinID: XP_024112305
Ensembl: ENSPPYG00000004626
LinkDB
Position
12
AA seq 1223 aa
MTGRRLKDQRDFGDQRRPWGDLGLGACESSLAFAGSARGDRPMAGARSRDPWGASGICYL
FGSLLVELLFSRAVAFNLDVMGALLKEGEPGSLFGFSVALHRQLQPQPQSWLLVGAPQAL
ALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIV
TCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQ
QGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSVDLAHLDDGPYEAGGEKEQDPRL
IPVPANSYFGLLFVTNIDSSDPDQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLV
HAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGW
PDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGISPLRLCGSPDSMFGISLAVLGDLNQD
GFPDIAVGAPFDGDGKVFIYHGSSLGVVAKPSQVLEGEAVGIKSFGYSLSGGLDMDGNQY
PDLLVGSLADTAVLFRARPILHVSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAV
PSGYSPTVALDYVLDADTDRRLRGQVPRVTFPSRNPEEPKHQASGTVWLKHQHDRVCGDA
MFQLQENVKDKLRAIVVTLSYSLQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLK
QGCGEDKICQSNLQLVRARFCTRISDTEFQPLPMDADGTTALFALSGQPVIGLELMVTNL
PSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPM
KRGAQVTFYLILSTSGISIETTELEVELLLATISEQELHPVSARARVFIELPLSIAGMAI
PQQLFFSGVVRGERAMQSEWDVGSKVKYEVTVSNQGQSLKTLGSAFLNIMWPHEIANGKW
LLYPVRVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGEQQEPSMSW
WPVSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSL
EVIVRANITVKSSIKNLMLRDASIVIPVMVYLDPMAVVVEGVPWWVILLAVLAGLLVLAL
LVLLLWKMGFFKRAKHPEATVPQYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDA
HPILAADGHPELGPDGHPGPSTA
NT seq 3672 nt   +upstreamnt  +downstreamnt
atgactgggagacgtctgaaagaccaacgagacttcggagaccagagacgcccctggggg
gacctggggcttggggcgtgcgagagttcccttgcattcgctgggagcgcgcgcggggat
cgtcccatggccggggctcggagccgcgacccttggggggcctccgggatttgctacctt
tttggctccctgctcgtcgaactgcttttctcacgggctgtcgccttcaatctggacgtg
atgggtgcgttgctcaaggagggcgagccaggcagcctcttcggcttctctgtggccctg
caccggcagttgcagccccaaccccagagctggctgctggtgggtgctccccaggccctg
gctcttcctgggcagcaggcgaatcgcactggaggcctcttcgcttgccccttgagcctg
gaggagactgactgctacagagtggacatcgaccagggagctgatatgcaaaaggaaagc
aaggagaaccagtggttgggagtcagtgttcggagccaggggcctgggggcaagattgtt
acctgtgcacaccgatatgaggcaaggcagcgagtggaccagatcctggagacgcgggat
atgattggtcgctgctttgtgctcagccaggacctggccatccgggatgagttggatggt
ggggaatggaagttctgtgagggacgcccccaaggccatgaacaatttgggttctgccag
cagggcacagctgccgccttctcccctgatagccactacctcctctttggggccccagga
acctataattggaagggcacggccagggtggagctctgtgcacagggctcagtggacctg
gcacacttggacgacggtccctacgaggcggggggagagaaggagcaggacccccgcctc
atcccggtccctgccaacagctactttgggttgctttttgtgaccaacattgatagctca
gaccccgaccagctggtgtataaaactttggaccctgctgaccggctcccaggaccagcc
ggagacttggccctcaatagctacttaggcttctctattgactcggggaaaggtctggtg
catgcagaagagctgagctttgtggctggagccccccgtgccaaccacaagggtgcagtg
gtcatcctgcgcaaggacagcgccagtcgcctggtgcccgaggttatgctgtctggggag
cgcctgacctctggcttcggctactcactggctgtggctgacctcaacagtgatggctgg
ccagacctgatagtgggtgccccctacttctttgagcgccaagaagaactggggggtgcc
gtttatgtgtacttgaaccaggggggtcactgggctgggatctcccctctccggctctgc
ggctcccctgactccatgttcgggatcagcctggctgtactgggggacctcaaccaagat
ggctttccagatattgcagtgggtgccccctttgatggtgatgggaaagtcttcatctac
catgggagcagcctgggggttgtcgccaaaccttcacaggtgctggaaggcgaggctgtg
ggcatcaagagctttggctactccctgtcaggcggcttggatatggatgggaaccaatac
cctgacctgctggtgggctccctggctgacaccgcagtgctcttcagggccagacccatc
ctccatgtctcccatgaagtctctattgctccacgaagcatcgacctggagcagcccaac
tgtgctggtggccactcggtctgtgtggacctaagggtctgtttcagctacattgcagtc
cccagcggctatagccctactgtggccctggactacgtgttagacgcggacacagaccgg
aggctccggggccaggttccccgtgtgacgttcccgagccgtaacccagaagaacccaag
caccaggcctcgggcaccgtgtggctgaagcaccagcatgaccgagtctgtggagacgcc
atgttccagctccaggaaaacgtcaaagacaagcttcgggccattgtagtgaccttgtcc
tacagtctccagacccctcggctccggcgacaggctcctggccaggggctgcctccagtg
gcccccatcctcaatgcccaccagcccagcacccagcgggcagagatccacttcttgaag
caaggctgtggtgaagacaagatctgccagagcaatctgcagctggtccgtgcccgcttc
tgtacccggatcagcgacacagaattccagcctctgcccatggatgcggatggaacaaca
gccctgtttgcactgagtgggcagccagtcattggcctggagctgatggtcaccaacctg
ccatcggacccagcccagccccaggctgatggggatgatgcccatgaagcccagctcctg
gtcatgcttcctgactcactgcactactcaggagtccgggccctggaccctgcggagaag
ccactctgcctgtccaatgagaatgcctcccatgttgagtgtgagctggggaaccccatg
aagagaggtgcccaggtcaccttctacctcatccttagcacctcagggatcagcattgag
accacggaactggaggtagagctgctgttggccacgatcagtgagcaggagctgcatcca
gtctctgcacgagcccgtgtcttcattgagctgccactgtccatcgcagggatggccatt
ccccagcaactcttcttctctggcgtggtgaggggcgagagagccatgcagtctgagtgg
gatgtgggcagcaaggtcaagtatgaggtcacggtttccaaccaaggccagtcgctcaaa
accctgggctctgccttcctcaacatcatgtggcctcatgagattgccaatgggaagtgg
ttgctgtacccagtgcgggtggagctggagggcgggcaggggcctgggcagaaagggctt
tgctctcccaggcccaacatcctccacctggatgtggacagtagggataggaggcggcgg
gagctggagccgcctgagcagcaggagcctggtgagcagcaggagcccagcatgtcctgg
tggccagtgtcctctgctgagaagaagaaaaacatcaccctggactgcgcccggggcacg
gccaactgtgtggtgttcagctgcccactctacagctttgaccgcgcagctgtgctgcat
gtctggggccgtctctggaacagcacctttctggaggagtactcagctgtgaagtccctg
gaagtgattgtccgggccaacatcacagtgaagtcctccataaagaacttgatgctccga
gatgcctccatagtgatcccagtgatggtatacttggaccccatggctgtggtggtagaa
ggagtgccctggtgggtcatcctcctggctgtactggctgggctgctggtgctagcactg
ctggtgctgctcctgtggaagatgggattcttcaaacgggcgaagcaccccgaggccacc
gtgccccagtaccatgcggtgaagattcctcgggaagaccgacagcagttcaaggaggag
aagacgggcaccatcctgaggaataactggggcagcccccggcgggagggcccggatgca
caccccatcctggctgccgacgggcatcccgagctgggccccgatgggcatccagggcca
agcaccgcctag

KEGG   Pongo abelii (Sumatran orangutan): 100441139
Entry
100441139         CDS       T01416                                 

Gene name
ITGA4
Definition
(RefSeq) integrin alpha-4 isoform X1
  KO
K06483  integrin alpha 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04640  Hematopoietic cell lineage
pon04670  Leukocyte transendothelial migration
pon04672  Intestinal immune network for IgA production
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100441139 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100441139 (ITGA4)
   04514 Cell adhesion molecules
    100441139 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100441139 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100441139 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100441139 (ITGA4)
   04670 Leukocyte transendothelial migration
    100441139 (ITGA4)
   04672 Intestinal immune network for IgA production
    100441139 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100441139 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100441139 (ITGA4)
   05414 Dilated cardiomyopathy
    100441139 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100441139 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100441139 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100441139 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100441139 (ITGA4)
   04515 Cell adhesion molecules [BR:pon04515]
    100441139 (ITGA4)
   04090 CD molecules [BR:pon04090]
    100441139 (ITGA4)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100441139 (ITGA4)
  Exosomal proteins of other cancer cells
   100441139 (ITGA4)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100441139 (ITGA4)
CD molecules [BR:pon04090]
 Proteins
  100441139 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 100441139
NCBI-ProteinID: XP_002812692
Ensembl: ENSPPYG00000012988
UniProt: A0A663DG96 H2P811
LinkDB
Position
2B
AA seq 1032 aa
MAWEARREPGPRRAAVRETVMLLLCLGVPTGCPYNVDTESALLYQGPPNTLFGYSVVLHS
HGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGMPPDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
KQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMEINLVG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRADGISSTFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCVENGWPSVCMDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGT
SDVITGSIQVSSRVANCRTHRAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQ
PILQQKKEKDIIKKTINFARFCAHENCSADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHVKLPVGLYFIKILELEDKQINCEVTDNSGMVQLDCSIGYIYVDH
LSSIDISFLLDVSSLSRAEEDLNITVHATCENEGEMDNLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVQFLSKTDKRLLYCIKADPHCLNF
LCNFGKMESGKEASVHIQLEGRPTILEMDETSALKFEIRATGFPEPNPRVIELNKDENVV
HVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRD
SWSYINSKSNDD
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcttgggaagcgaggcgcgaacccggcccccgaagggccgccgtccgggagacggtg
atgctgttgctgtgcctgggggtcccgaccggctgcccctacaacgtggacactgagagc
gcgctgctttaccagggcccccccaacacgctgttcggctactcggtcgtgctgcacagc
cacggggcgaaccgatggctcttagtgggtgcgcccactgccaactggctcgccaacgct
tcagtgatcaatcccggggcgatttacagatgcaggatcggaaagaatcccggccagacg
tgcgaacagctccagctgggtagccctaatggagaaccttgtggaaagacttgtttggaa
gagagagacaatcagtggttgggggtcacactttccagacagccaggagaaaatggatcc
attgtgacttgtgggcatagatggaaaaatatattttacataaagaatgaaaataagctc
cccactggtggttgctatggaatgccccctgatttacgaacagaactgagtaaaagaata
gctccatgttatcaagattatgtgaaaaaatttggagaaaattttgcatcatgtcaagct
ggaatatctagtttttacacaaaggatttaattgtgatgggagccccaggatcatcttat
tggactggctctctttttgtctacaatataactacaaataagtacaaggcttttttagac
aaacaaaatcaagtaaaatttggaagttatttaggatattcggttggagctggtcatttt
cggagccagcatactaccgaagtagttggaggagctcctcaacatgagcagattggtaaa
gcatatatattcagcattgatgaaaaagaactaaatatcttacatgaaatgaaaggtaaa
aagcttggatcgtactttggagcttctgtgtgtgctgtggacctcaacgcagatggcttc
tcagatctgctcgtgggagcacccatgcagagcaccatcagagaggaaggaagagtgttt
gtgtacatcaactctggctcgggagcagtaatgaatgcaatggaaataaacctcgttgga
agtgacaaatatgctgcaagatttggggaatctatagttaatcttggcgacattgacaat
gatggctttgaagatgttgctatcggagctccacaggaagatgacttgcgaggtgctatt
tatatttacaatggccgtgcagatgggatctcatcaaccttctcacagagaattgaagga
cttcagatcagcaaatcgttaagtatgtttggacagtctatatcaggacaaattgatgca
gataataatggttatgtagatgtagcagttggtgcttttcggtctgattctgctgtgttg
ctaaggacaagacctgtagtaattgttgaagcttctttaagccaccctgagtcagtaaat
agaacgaaatttgactgtgttgaaaatggatggccttctgtgtgcatggatctaacactt
tgtttctcatataagggcaaggaagttccaggttacattgttttgttttataacatgagt
ttggatgtgaacagaaaggcagagtctccaccaagattctatttttcttctaatggaact
tctgacgtgattacaggaagcatacaagtgtccagcagagtagctaactgtagaacacat
cgagcatttatgcggaaagatgtgcgggacatccttaccccaattcagattgaagctgct
taccaccttggtcctcatgtcatcagtaaacgaagtacagaggaattcccaccgcttcag
ccaattcttcagcagaagaaagaaaaagacataattaaaaaaacaataaactttgcaagg
ttttgtgcccatgaaaattgttctgctgatttacaggtttctgcaaagattgggtttttg
aagccccatgaaaataaaacgtatcttgctgttgggagtatgaagacattaatgttgaat
gtgtccttgtttaatgctggagatgatgcatatgaaacgactctacatgtcaaactaccc
gtgggtctttatttcattaagattttagagctggaagataagcaaataaactgtgaagtc
acagataactctggcatggtacaacttgactgcagtattggctatatatatgtagatcat
ctctcaagcatagatattagctttctcctggatgtgagctcactcagcagagcagaagag
gacctcaatatcacagtgcatgctacctgtgaaaatgaaggggaaatggacaatctaaag
cacagcagagtcactgtagcaatacctttaaaatatgaggttaagctgactgttcatggg
tttgtaaacccaacttcatttgtgtatggatcaaatgatgaaaatgagcctgaaacgtgc
atggtggagaaaatgaacttaactttccatgttatcaacactggcaatagcatggctccc
aatgttagtgtggaaataatggtaccaaattcttttagcccccaaactgataagctgttc
aacattttggatgtccagactactactggagaatgccactttgaaaattatcaaagagtg
tgtgcattagagcagcaaaagagtgcaatgcagaccttgaaaggcatagtccagttcttg
tccaagactgataagaggctattgtactgcataaaagctgatccacattgtttaaatttc
ctgtgtaattttgggaaaatggaaagtggaaaagaagccagtgttcatatccaattggaa
ggccggccaaccattttagaaatggatgagacttcagcactcaagtttgaaataagagca
acaggttttccagagccaaatccaagagttattgaactaaacaaggatgagaatgttgtg
catgttctactggaaggactacatcatcaaagacctaaacgttatttcaccatagtgatt
atttcaagtagcttgctacttggacttattgtacttctgttgatctcatatgtcatgtgg
aaggccggcttctttaaaagacaatacaaatctatcctacaagaagaaaacagaagagac
agttggagttatatcaacagtaaaagcaatgatgattaa

KEGG   Pongo abelii (Sumatran orangutan): 100442074
Entry
100442074         CDS       T01416                                 

Gene name
ITGA8
Definition
(RefSeq) integrin alpha-8 isoform X1
  KO
K06584  integrin alpha 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100442074 (ITGA8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100442074 (ITGA8)
   04514 Cell adhesion molecules
    100442074 (ITGA8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100442074 (ITGA8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100442074 (ITGA8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100442074 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100442074 (ITGA8)
   05414 Dilated cardiomyopathy
    100442074 (ITGA8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100442074 (ITGA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pon04515]
    100442074 (ITGA8)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100442074 (ITGA8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 100442074
NCBI-ProteinID: XP_024109685
LinkDB
Position
10
AA seq 1097 aa
MSTGASRGPRGSQAPLIAPLCCAAAALGMMLWSPASQAFNLDVEKLTVYSGPKGSYFGYA
VDFHIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGYVSI
INSTDMMFIQNFTGEQMASYFGYTVVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILIGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQRGKVL
IYNGNKDGLNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLHPMIINLENKTCQLPDSMTSAACFSLRVCASVTGQSIANTIVLMA
EVQLDSLKQKGAIKRTLFLENHQAHRIFPLVIKWQKSHQCQDFIVYLRDETEFRDKLSPI
NISLNYSLDESIFKEGLEVKPILNYYRENIVSEQAHILVDCGEDNLCVPDLKLSARTDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVPRLEKTNMSINFNLQIRSSNKDNPDSNFVSLQIN
ITAVAQVEIRGVSHPPQIVLPIQNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTIL
EVGWPFSARDEFLLYIFHIQTLGPLQCHTNPNINPQDIKPAASPEDTPELSAFLRNSTIP
HLVRKRDVPVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQ
RKNDPYALASLVSFEVKKMPYKDQPAKLPEGSIADCIFLRWPQVTACCSQLISKDPQNNP
IHAFPSPATPFIELPKKKDFLSDVGDLPHQLCEGYWKKIQEWKHFQVSQYLTNWRRPCQC
EVSYAAHREMLPYCGLM
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgtcgaccggggccagccgcggtccccggggaagccaggcgccgctgatcgcgcccctc
tgctgcgccgcggcagcgctggggatgatgctgtggtcccctgcctctcaggcgttcaac
ctggacgtggaaaagctcacggtgtacagcggccccaagggcagctacttcggctacgcc
gtggacttccacatacccgacgcccgcacagcgagtgtcttggtgggggcgccgaaagcc
aacaccagccagcccgatatcgtggaagggggagccgtctattactgtccttggcccgcg
gaggggtctgcgcagtgcaggcagataccgtttgacaccaccaacaacagaaagatcaga
gttaatggaaccaaagaacctatcgagttcaaatccaatcagtggtttggagcaacagtg
aaagctcacaaaggaaaagttgtggcctgtgctcctttatatcactggagaactcttaaa
ccgacaccagaaaaggacccagttggcacctgctatgtagcaattcagaacttcagcgcc
tatgccgagttctctccttgccggaacagcaatgctgatccggaaggccagggttactgc
caagcaggatttagtctggatttttataagaatggagaccttattgtgggaggacctggg
agtttctactggcaagggcaagtgatcactgccagtgttgcagatatcattgcaaattac
tcattcaaggatatcctcaggaaattggcaggagaaaagcagacggaagtggctccagct
tcctatgatgacagttaccttggatactcagttgctgctggggagtttactggggattct
cagcaagaactggttgctggagttccaagaggagcacagaattttggatatgtttcaatc
attaactctacggatatgatgtttattcagaatttcactggcgaacagatggcatcttat
tttggatataccgttgtcgtatcagatgttaacagtgacggactggatgatgtcctggtt
ggggcacctctctttatggaacgtgaatttgagagcaaccccagagaagtagggcaaatc
tacctgtatttgcaagtgagctctctcctcttcagagacccccagatcctcatcggcacc
gagacgtttgggagattcggtagtgctatggcgcacttaggagacctgaaccaagatgga
tacaatgacattgccatcggcgtgccttttgcaggcaaggatcaaagaggcaaagtgctc
atttataatgggaacaaagatggcttaaacaccaagccttcccaagttctgcaaggagtg
tgggcctcacacgctgtcccttctggatttggctttactttaagaggagattcagacata
gacaagaatgattacccagatttgattgtgggtgcatttggaacaggaaaagtcgctgtt
tacagagcaagaccggttgtgactgtagatgcccagcttctgctgcacccaatgattatc
aatcttgaaaataaaacttgccagcttccagactctatgacatctgcagcctgcttttct
ttaagagtatgtgcatctgtcacaggccagagcattgcaaacacaatagtcttgatggca
gaggtgcaattagattccctgaaacagaaaggagccattaaacggacactcttccttgaa
aaccatcaggctcatcgcatcttccctcttgttataaaatggcagaaatcccaccagtgc
caggatttcatcgtttaccttcgagatgaaactgaattccgagataaattatctccaatc
aacattagtttgaattacagtttggacgaatccatctttaaagaaggcctggaagtgaaa
ccaatattgaactactacagagaaaacattgttagtgaacaggctcacattctggtggac
tgtggagaagacaatctgtgtgttcctgacttgaagctgtcagctagaacagataagcat
caggtaatcattggagatgaaaatcaccttatgctcataataaatgcaagaaatgaaggg
gaaggagcatatgaagctgaactctttgtaatgataccagaagaggcagattatgttggg
atcgaacgcaacaacaagggatttcgaccactgagctgtgagtacaagatggaaaatgta
accaggatggtagtgtgcgaccttgggaaccctatggtgtctggaacaaattattccctg
ggcctccgatttgcagttccacgtcttgagaaaacaaacatgagcattaacttcaatctc
caaatcagaagttccaacaaggacaatccagacagcaattttgtgagcctgcaaatcaac
atcactgctgtagcacaggtggaaataagaggagtgtcacaccctccgcagattgttctg
cccattcaaaactgggaaccagaagaggagccccacaaagaggaggaggttggaccattg
gtggaacatatttatgagctgcacaatattggaccaagtaccatcagtgacaccatcctg
gaggtgggctggcctttctctgcccgggatgaatttcttctctatattttccatattcaa
actctgggacctctgcagtgccacactaatcctaatatcaatccacaggatataaagcct
gctgcctccccagaggacacccctgagctcagcgcctttttgcgaaactctactattcct
catcttgtcaggaagagggatgtgcccgtggtcgaattccacagacagagccctgcaaaa
atactgaattgtacaaatatcgagtgtttacaaatctcctgtgcagtgggacgactcgaa
ggaggagaaagcgcagtcctgaaagtcaggtcacgattatgggcccacaccttcctccag
agaaaaaatgatccctatgctcttgcatccctggtttcctttgaagttaagaagatgcct
tataaagatcagccagcaaaactcccagaaggaagcatagccgattgcatctttctgcgc
tggccacaggtgacagcctgctgttctcaactcatctcaaaagatccacaaaataatccg
atacatgctttccccagccctgccaccccttttattgaattgccaaaaaaaaaagacttt
ttatctgatgtaggtgatttaccacatcagttatgtgaaggttattggaaaaagatccag
gaatggaaacactttcaagtctcccaatatctgactaactggagaagaccttgccagtgc
gaagttagctatgcagcacacagggaaatgctgccttactgtggcttgatgtga

KEGG   Pongo abelii (Sumatran orangutan): 100442478
Entry
100442478         CDS       T01416                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon05145  Toxoplasmosis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100442478 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100442478 (ITGA6)
   04514 Cell adhesion molecules
    100442478 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100442478 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100442478 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100442478 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100442478 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100442478 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100442478 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100442478 (ITGA6)
   05414 Dilated cardiomyopathy
    100442478 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100442478 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100442478 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100442478 (ITGA6)
   04515 Cell adhesion molecules [BR:pon04515]
    100442478 (ITGA6)
   04090 CD molecules [BR:pon04090]
    100442478 (ITGA6)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100442478 (ITGA6)
  Exosomal proteins of breast milk
   100442478 (ITGA6)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100442478 (ITGA6)
CD molecules [BR:pon04090]
 Proteins
  100442478 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 100442478
NCBI-ProteinID: XP_024098928
Ensembl: ENSPPYG00000012936
LinkDB
Position
2B
AA seq 1091 aa
MAAAGHLCLLYLSAGLLPRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHVFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTK
PTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINVQKTITVTPNR
IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQNEINVLNLKESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNGT
FLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggccgccgcggggcatctgtgcttgctctacctgtcggcggggctcctgccccggctc
ggcgcagccttcaacttggacactcgggaggacaacgtgatccggaaatatggagacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgctcgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaacg
ggagggctgtacagctgcgacatcaccgcccgggggccatgcacgcggattgaatttgat
aacgatgctgaccccacgtcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagccagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgagcacgatgaaagtctcgttcctgttcccgctaacagttacttaggtttt
tctctggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctaaagagagacatgaagtctgcacat
ctcctccctgagcacgtattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtaaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctcca
tatgatgacttgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
ccaacacaggttctcaagggtatatcaccttattttggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatgttcagaaaaccatcacagtaactcctaacaga
attgacctccgccagaaaacagcgtgtggggcgcctagcgggatatgcctccaggttaaa
tcctgtttcgaatatactgctaaccccgctggttataatccttcaatatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatctgggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatactcaagaactaactctgaagcggcagaaacagaaa
gtgtgcatggaggaaaccctgtggctacaggataatattagagataaactgcgtcccatt
cccataactgcttcagtggagatccaagagccaagctctcgtaggcgagtgaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatattgatgttcac
tttttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaaactagaatat
aaattttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgatgcccatgaggctaaactg
attgcaacgtttccggacactttaacatattccgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcacaagctgactgtgagcttgga
aatccttttaaaagaaattcaaatgtcactttttatttggttttaagtacaactgaagtc
acctttgacaccccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagtagttggtgaacaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaataaacttaggt
aaacctcttacaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatgggaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagataact
tgtgagccacaaaatgagataaatgtcctgaacctaaaggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagacgataacagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagcgtgaacgtgaactgtgtgaacatcagatgccca
ctgcgagggctggacagcaaggcgtctcttattttgcgctcgaggttatggaatggcaca
tttctagaggaatattccaaactgaactacttggacattctcatgcgagccttcattgat
gtgactgctgctgctgaaaatatcaggctgccaaatgcaggcactcaggttcgtgtgact
gtgtttccctcaaagactgtagctcagtattcgggagtaccttggtggatcatcctagtg
gctattctcgctgggatcttgatgcttgctttattagtgtttatactatggaagtgtgga
ttctttaaacgctctaggtacgatgacagtgttccccgataccatgccgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaatgaaaatgaaagctactcatag

KEGG   Pongo abelii (Sumatran orangutan): 100451792
Entry
100451792         CDS       T01416                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V
  KO
K06487  integrin alpha V
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04810  Regulation of actin cytoskeleton
pon04919  Thyroid hormone signaling pathway
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100451792 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100451792 (ITGAV)
   04514 Cell adhesion molecules
    100451792 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100451792 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100451792 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100451792 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100451792 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451792 (ITGAV)
   05205 Proteoglycans in cancer
    100451792 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100451792 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100451792 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    100451792 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100451792 (ITGAV)
   05414 Dilated cardiomyopathy
    100451792 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100451792 (ITGAV)
   05165 Human papillomavirus infection
    100451792 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100451792 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100451792 (ITGAV)
   04515 Cell adhesion molecules [BR:pon04515]
    100451792 (ITGAV)
   04090 CD molecules [BR:pon04090]
    100451792 (ITGAV)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100451792 (ITGAV)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100451792 (ITGAV)
  Exosomal proteins of epithelial cells
   100451792 (ITGAV)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100451792 (ITGAV)
CD molecules [BR:pon04090]
 Proteins
  100451792 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 100451792
NCBI-ProteinID: XP_024099080
Ensembl: ENSPPYG00000013007
LinkDB
Position
2B
AA seq 1048 aa
MASPPRRRLRLGPRVLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggcttctccgccgcggcgacggctgcgcctcggtccccgcgtcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctagacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgcggtggatttcttcgtgcccagcgcg
tcttcccggatgtttcttctcgtgggagctcccaaagcaaacaccacccagcctgggatt
gtggaaggagggcaagtcctcaaatgtgactggtcttctacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggatgatccattggaatttaagtcc
catcagtggtttggagcatctgtgaggtcgaaacaggataaaattttggcctgtgcccca
ttgtaccattggaggactgagatgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgtagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatatgaccccaatgtttacagcatcaagtataataaccaattagcaact
cgaactgcacaagctattttcgatgacagttatttgggttactctgtggctgttggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccttatataattttactggcgag
cagatggctgcatatttcggattttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccaa
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacgacaaag
ctgaatgggtttgaggtctttgcacggtttggcagtgccatagctcctttgggagatctg
gaccaggatggtttcaacgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaacaggcttgaacgcagtcccatcacaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaattgtaggagcttttggtgtagat
cgagctatcttatacagggccagaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgttttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccaggaaa
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttctctacagcaggtccccaagtcactccaagaacatgactatttcaaggggg
ggactgatgcaatgtgaggaattgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccaattactatttttatggaatatcggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctccttgactgtggtgaagacaatgtctgtaaacccaagctggaagtttctgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctatgaagctgagctcatcgtttccattccactgcag
gctgatttcatcggggttgtccgaaacaatgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctatttgacaaagtaagcccagttgta
tctcacaaagttgaccttgctgttttagctgcagttgagataagaggagtctctagtcct
gatcatatctttcttccgattccaaactgggagcacaaggagaaccctgagactgaagaa
gatgttgggccagttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatgctccatcttcagtggccttacaaatataataataatactctgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatctcatctttgcaaacaactgaaaagaatgacacggttgctgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgcggagtcgctcagtgcttgaagattgtctgccaagttgggcgattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacgtttatgaat
aaagaaaatcagaatcattcctattctctgaagtcatctgcttcatttaatgtcatagag
tttccttataagaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcgcccatgcctgtgcctgtgtgggtgatcattttagca
gttctagcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaagaacaagaaagggaacagcttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

KEGG   Pongo abelii (Sumatran orangutan): 100452800
Entry
100452800         CDS       T01416                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100452800 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    100452800 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100452800 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100452800 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100452800 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100452800 (ITGA2B)
   04611 Platelet activation
    100452800 (ITGA2B)
   04613  Neutrophil extracellular trap formation
    100452800 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452800 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100452800 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100452800 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    100452800 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100452800 (ITGA2B)
   05414 Dilated cardiomyopathy
    100452800 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100452800 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100452800 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100452800 (ITGA2B)
   04515 Cell adhesion molecules [BR:pon04515]
    100452800 (ITGA2B)
   04090 CD molecules [BR:pon04090]
    100452800 (ITGA2B)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100452800 (ITGA2B)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100452800 (ITGA2B)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100452800 (ITGA2B)
CD molecules [BR:pon04090]
 Proteins
  100452800 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 100452800
NCBI-ProteinID: XP_002827479
Ensembl: ENSPPYG00000008330
UniProt: A0A663D9T1 H2NTU0
LinkDB
Position
17
AA seq 1039 aa
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSHFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLFFDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYMENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRP
GILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEI
LDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV
LVFLGQSEGLSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVRSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSL
NVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLELQMDAANEGEGAYEAELAVHLPQGTHYMRALSNVEGFERLICNQKKENETRVVLCEL
GNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVE
LRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQP
SDLLYILDIQPQGGLQCFPQPHVNPLKVDWGLPTPSPSPIHPAHHKRDRRQIFLPEPEQP
SRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAW
FNVSSLPYAVPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWK
VGFFKRNRPPLEEDDEEGE
NT seq 3120 nt   +upstreamnt  +downstreamnt
atggccagagctttgtgtccactgcaagccctctggcttctggagtgggtgctgctgctc
ttgggaccttgtgctgcccctccagcctgggccttgaacctggacccagtgcagctcacc
ttctatgcaggccccaatggcagccactttggattttcactggacttccacaaggacagc
catgggagagtggccatcgtggtgggcgccccgcggaccctgggccccagccaggaggag
acgggcggcgtgttcctgtgcccctggagggccgagggcggccagtgcccctcgctgttc
tttgacctccgtgatgagacccgaaatgtaggctcccaaactttacaaaccttcaaggcc
cgccaaggactgggggcgtcggtcgtcagctggagcgacgtcattgtggcctgcgccccc
tggcagcactggaacgtcctagaaaagactgaggaggctgagaagacgcccgtaggcagc
tgctttttggctcaaccagagagcggccgccgcgccgagtactccccctgtcgtgggaac
accctgagccgcatttacatggaaaatgattttagctgggacaagcgttactgtgaagcg
ggcttcagctccgtggtcactcaggccggagagctggtgcttggggctcctggcggctat
tatttcttaggtctcctggcccaggctccaattgcggatattttctcgagttaccgccca
ggcatccttttgtggcacgtgtcctcccagagcctctcctttgactccagcaacccagag
tacttcgacggctactgggggtactcggtggccgtgggcgagttcgacggggatctcaac
actacagagtatgtcgtcggtgcccccacttggagctggaccctgggagcggtggaaatt
ttggactcctactaccaaaggctgcaccggctgcgcggagagcagatggcgtcgtatttt
gggcattcagtggctgtcactgacgtcaacggggatgggaggcatgatctgctggtgggc
gctccgctgtatatggagagccgggcagaccgaaaactggccgaagtggggcgtgtgtat
ttgttcctgcagccgcgaggcccccacgcactgggtgcccccagcctcctgctgactggc
acacagctctatgggcgattcggctctgccatcgcacccctgggcgacctcgaccgggat
ggctacaatgacattgcagtggctgccccctatgggggtcccagtggccgcggccaagtg
ctggtgttcctgggtcagagtgaggggctgagctcacgtccctcccaggtcctggacagc
cccttccccacaggctctgcctttggcttctcccttcgaggtgccgtagacatcgatgac
aacggatacccagacctgatcgtgggagcttacggggccaaccaggtggctgtgtacaga
gctcagccagtggtgaaggcctctgtccagctactggttcaagattcactgaatcctgct
gtgaggagctgtgtcctaccccagaccaagacacccgtgagctgcttcaacatccagatg
tgtgttggagccactgggcacaacattcctcagaagctatccctaaatgccgagctgcag
ctggaccggcagaagccccgccagggccggcgggtgctgctgctgggctctcaacaggca
ggcaccaccctgaacctggatctgggtggaaagcacagccccatctgccacaccaccatg
gccttccttcgagatgaggcagacttccgggacaagctgagccccattgtgctcagcctc
aatgtgtccctaccgcccacggaggctggaatggcccctgctgtcgtgctgcatggagac
acccatgtgcaggagcagacacgaatcgtcctggactgcggggaagatgacgtgtgtgtg
ccccagcttcagctcactgccagcgtgacgggctccccgctcctagttggggcagataat
gtcctggagctgcagatggatgcagccaacgagggcgagggggcctatgaagcagagctg
gctgtgcacctgccccagggcacccactatatgcgggccctaagcaacgtcgagggcttt
gagagactcatctgtaatcagaagaaggagaatgagaccagggtggtgctgtgtgagctg
ggcaaccccatgaagaagaatgcccagataggaatcgcgatgttggtgagcgtggggaat
ctggaagaggctggggagtctgtgtccttccagctgcagatacggagcaagaacagccag
aatccaaacagcaagattgtgctgctggacgtgccggtccgagcagaggcccaagtggag
ctgcgagggaactcctttccagcctctctggtggtggcggcagaagaaggtgagagggag
cagaacagcttggacagctggggacccaaagtggagcacacctatgagctccacaacaat
ggccctgggactgtgaatggccttcacctcagcatccacctcccggggcagtcccagccc
tccgatctgctctacatcctggatatacagccccaggggggccttcagtgcttcccacag
cctcatgtcaaccccctcaaggtggactgggggctgcccacccccagcccctcccccatt
cacccggcccatcacaagcgggatcgcagacaaatcttcctgccagagcccgagcagccc
tcgaggcttcaggatccagttctcgtaagctgcgactcggcgccctgtactgtggtgcaa
tgtgaccttcaggagatggcgcgcgggcagcgggccatggtcacggtgctggccttcctg
tggctgcccagcctctaccagaggccactggatcagtttgtgctgcagtcgcacgcatgg
ttcaacgtgtcctccctcccctatgcggtgccccccctcagcctgccccgaggggaagct
caggtgcggacacagctgctccgggccttggaggagagggccattccaatctggtgggtg
ctggtgggtgtgctgggtggcctgctgctgctcaccatcctggtcctggccatgtggaag
gttggcttcttcaagaggaaccggccacccctggaagaagatgatgaagagggggagtga

KEGG   Pongo abelii (Sumatran orangutan): 100453984
Entry
100453984         CDS       T01416                                 

Gene name
ITGA5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05133  Pertussis
pon05135  Yersinia infection
pon05165  Human papillomavirus infection
pon05168  Herpes simplex virus 1 infection
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100453984 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100453984 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100453984 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100453984 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100453984 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100453984 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100453984 (ITGA5)
   05205 Proteoglycans in cancer
    100453984 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100453984 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100453984 (ITGA5)
   05414 Dilated cardiomyopathy
    100453984 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100453984 (ITGA5)
   05133 Pertussis
    100453984 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    100453984 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100453984 (ITGA5)
   05165 Human papillomavirus infection
    100453984 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100453984 (ITGA5)
   04515 Cell adhesion molecules [BR:pon04515]
    100453984 (ITGA5)
   04090 CD molecules [BR:pon04090]
    100453984 (ITGA5)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100453984 (ITGA5)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100453984 (ITGA5)
CD molecules [BR:pon04090]
 Proteins
  100453984 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 100453984
NCBI-ProteinID: XP_024112486
Ensembl: ENSPPYG00000004604
LinkDB
Position
12
AA seq 1098 aa
MPPRQPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTSESPLH
AVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPGT
DGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAP
CRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLI
NLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDI
RSLYNFSGEQMASYFGYAVTATDINGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYIYLQH
PAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGG
PGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRP
IVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQ
KQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFS
LDPQAPVDSHGLRPALHYHSNSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDK
NALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVC
DLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQ
VTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQ
ALEGQQLLYVTRVMGLNCTTNHPINPKGLELDPEGSLHHRQKREAPSRSSASSGPQILKC
PEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRIL
PQQLPQKERHVATAVQWTKAEGSHGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLP
YGTAMEKAQLKPPATSDA
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgcccccccgccagccccctcggcaggcggggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagccggacgtcagagtcccctctccac
gccgtgcagctccgctggggcccccggcgccgacccccgctgctgccgctgctgttgctg
ctgctgccgccgccacccagggtcgggggcttcaacttagacgcggaggccccagcagtg
ctctcggggcccccgggctccttcttcggattctcagtggagttttaccggccgggaaca
gacggggtcagtgtgctggtgggagcacccaaggctaacaccagccagccaggagtgctg
cagggtggtgctgtctacctctgtccttggggtgccagccccacacagtgcacccccatt
gaatttgacagcaaaggctctcggctcctggagtcctcactgtccagctcagagggagag
gagcctgtggagtacaagtccttgcagtggttcggggcaacagttcgagcccatggctcc
tccatcttggcatgcgctccactgtacagctggcgcacagagaaggagccactgagcgac
cccgtgggcacctgctacctctccacagacaacttcactcgaattctggagtatgcaccc
tgccgctcagatttcagctgggcagcaggacagggttactgccaaggaggcttcagcgcc
gagttcaccaagactggccgtgtggttttaggtggaccaggaagctatttctggcaaggc
cagatcctgtctgccactcaggagcagattgcagaatcttattaccccgagtacctgatc
aacctggttcaggggcagctgcagactcgccaggccagttccatctatgatgacagctac
ctaggatactctgtggctgtgggtgaattcagtggtgatgacacagaagactttgttgct
ggtgtgcccaaagggaacctcacttacggctatgtcaccatccttaatggctcagacatc
cgatccctctacaacttctcaggggaacagatggcctcctactttggctatgcagtgact
gccacagacatcaatggggatgggctggatgacttgctggtgggggcacccctgctcatg
gatcggacccctgacgggcggcctcaggaggtgggcagggtctacatctacctgcagcac
ccagccggcatagagcccacgcccacccttaccctcactggccatgatgagtttggtcga
tttggcagctccttgacccccctgggggacctggaccaggatggctacaatgatgtggcc
atcggggctccctttggtggggagacccagcagggagtagtgtttgtattccctgggggc
ccaggagggctgggctctaagccttcccaggttctgcagcccctgtgggcagccagccac
accccagacttctttggctctgcccttcgaggaggccgagacctggatggcaacggatac
cctgatctgattgtggggtcctttggtgtggacaaggctgtggtatacagaggccgcccc
atcgtgtccgccagtgcctccctcaccatcttccctgccatgttcaacccagaggagcgc
agctgcagcttagaggggaaccctgtggcctgcatcaaccttagcttctgcctcaatgct
tctggaaaacacgttgctgactccattggcttcacagtggaacttcagctggactggcag
aagcagaagggaggggtacggcgggcactgttcctggcctccaggcaggcaaccctgacc
cagaccctgctcatccagaatggggctcgagaggattgcagagagatgaagatctacctc
aggaacgagtcagaatttcgagacaaactctccccgattcacatcgctctcaacttctcc
ttggacccccaagccccagtggacagccacggcctcaggccagccctacattaccacagc
aacagccggatagaggacaaggctcagatcttgctggactgtggagaagacaacatctgt
gtgcctgacctgcagctggaggtgtttggggagcagaaccatgtgtacctgggtgacaag
aatgccctgaacctcactttccatgcccagaatgtgggtgagggtggcgcctatgaggct
gagcttcgggtcaccgcccctccagaggctgagtactcaggactcgtcagacacccaggg
aacttctccagcctgagctgtgactactttgccgtgaaccagagccgcctgctggtgtgt
gacctgggcaaccccatgaaggcaggagccagtctgtggggtggccttcggtttacagtc
cctcatctccgggacactaagaaaaccatccagtttgacttccagatcctcagcaagaat
ctcaacaactcgcaaagcgacgtggtttccttccggctctccgtggaggctcaggcccag
gtcaccctgaacggtgtctccaagcctgaggcagtgctattcccagtaagcgactggcat
ccccgagaccagcctcagaaggaggaggacctggggcctgctgtccaccatgtctatgag
ctcatcaaccaaggccccagctccattagccagggcgtgctggagctcagctgtccccag
gctctggaaggtcagcagctcctatatgtgaccagagttatgggactcaactgcaccacc
aatcaccccattaacccaaagggcctggagttggatcccgagggttccctgcaccaccgg
caaaaacgggaagctccaagccgcagctctgcttcctcgggacctcagatcctgaaatgc
ccggaggctgagtgtttcaggctgcgctgtgagctcgggcccctgcaccaacaagagagc
caaagtctgcagttgcatttccgagtctgggccaagactttcttgcagcgggagcaccag
ccatttagcctgcagtgtgaggctgtgtacaaagccctgaagatgccctaccgaatcctg
cctcagcagctgccccaaaaggagcgtcatgtggccacagctgtgcaatggaccaaggca
gaaggcagccatggtgtcccactgtggatcatcatcctagccattctatttggcctcctg
ctcctaggtctactcatctacatcctctacaagctcggattcttcaaacgctccctccca
tatggcaccgccatggaaaaagctcagctcaagcctccagccacctctgatgcctga

KEGG   Pongo abelii (Sumatran orangutan): 100454617
Entry
100454617         CDS       T01416                                 

Gene name
ITGA11
Definition
(RefSeq) integrin alpha-11 isoform X1
  KO
K06587  integrin alpha 11
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100454617 (ITGA11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100454617 (ITGA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100454617 (ITGA11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100454617 (ITGA11)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100454617 (ITGA11)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100454617 (ITGA11)
   05414 Dilated cardiomyopathy
    100454617 (ITGA11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100454617 (ITGA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pon04515]
    100454617 (ITGA11)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100454617 (ITGA11)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Ku_N
Other DBs
NCBI-GeneID: 100454617
NCBI-ProteinID: XP_024088092
Ensembl: ENSPPYG00000006593
LinkDB
Position
15
AA seq 1188 aa
MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGA
PLETNGHQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMYNNRSLTIHQALRGQQIGSYF
GSEITSVDIDGDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNRFVYNGTLKDSHSYQNA
RFGSSIASVRDLNQDSYDDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATG
LQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCK
RSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAI
LLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRRRVAV
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKKVCNVSYPFL
RAKAKVAFRLDFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFT
RSSSLSHYEVKPNSSLERYDGIGPPFSCIFRIQNLGLFPIHGMMMRITIPIATRSGNRLL
KLRDFLTDQANTSCNIWGNSTEYRPTPMEEDLSRAPQLNHSNSDVVSINCNIRLVPNQEI
NFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQV
PIWIIVGSTLGGLLLLALLVLALWKLGFFKSARRRREPGLDPTPKVLE
NT seq 3567 nt   +upstreamnt  +downstreamnt
atggacctgcccaggggcctggtggtggcctgggcgctcagcctgtggccagggttcacg
gacaccttcaacatggacaccaggaagccccgggtcatccctggctccaggaccgccttc
tttggctacacagtgcagcagcacgacatcagtggcaataagtggctggtcgtgggcgcc
ccactggaaaccaatggccaccagaagacgggagacgtgtacaagtgtccagtgatccac
gggaactgcaccaaactcaacctgggaagggtcaccctgtccaacgtgtccgagcggaaa
gacaacatgcgccttggccttagtctcgccaccaaccccaaggacaacagcttcctggcc
tgcagccccctctggtctcacgagtgtgggagctcctactacaccacagggatgtgttca
agagtcaactccaacttcaggttctccaagaccgtggccccagctctccaaaggtgccag
acctacatggacatcgtcatcgtcctggatggctccaacagcatctacccctgggtggag
gttcagcacttcctcatcaacatcctgaagaagttttacattggcccagggcagatccag
gttggagttgtgcagtatggagaagatgtggtgcatgagtttcacctcaatgactacagg
tctgtaaaagatgtggtagaagctgccagccacattgagcagagaggaggaacagagacc
cggacagcatttggcattgaatttgcacgctctgaggctttccagaagggcggaaggaaa
ggggccaagaaggtgatgattgtcatcacagatggggagtcccacgacagcccagacctg
gagaaggtgatccagcaaagcgagagagacaacgtaacaagatatgcggtggctgtcctg
ggctactacaaccgcagggggatcaatccagaaacttttctaaatgaaatcaaatacatc
gccagtgaccctgatgacaagcacttcttcaatgtcactgatgaggctgccttgaaggac
attgtcgatgccctgggggacagaatcttcagcctggaaggcaccaacaagaacgagacc
tcctttgggctggagatgtcacagacaggcttttcctcacacgtggtggaggatggggtt
ctgctgggagccgttggtgcctatgactggaacggagctgtgctaaaggagacaagtgcc
gggaaggtcattcctctccgcgagtcctacctgaaagagttccccgaggagctcaagaac
catggtgcatacctggggtacacagtcacatcggtcgtgtcctccaggcaggggcgggtg
tacgtggccggagccccccggttcaaccacacaggcaaagtcatcctgttcaccatgtac
aacaaccggagcctcaccatccaccaggctctgcggggccagcagataggctcttacttt
gggagtgaaatcacctcggtggacatcgacggcgatggcgtgactgatgtcctgctggtg
ggtgcacccatgtacttcaacgagggccgtgagcgaggcaaggtgtacgtctacgagctg
agacagaaccggtttgtttataacggaacgctaaaggattcacacagttaccagaatgcc
cgatttgggtcctccattgcctcagttcgagacctcaaccaggattcctacgatgacgtg
gtggtgggagcccccctggaggacaaccacgcaggagccatctacatcttccacggcttc
cgaggcagcatcctgaagacacctaagcagagaatcacagcctcagagctggctaccggc
ctccagtattttggctgcagcatccacgggcaattggacctcaatgaggatgggctcatc
gacctggcagtgggagcccttggcaacgctgtgattctgtggtcccgccctgtggttcag
atcaatgccagcctccactttgagccatccaagatcaacatcttccacagagactgcaag
cgcagtggcagggatgccacctgcctggccgccttcctctgcttcacgcccatcttcttg
gcaccccatttccaaacaacaactgttggcatcagatacaacgccaccatggacgagagg
cggtatacaccaagggcccacctggacgaaggcggggaccgattcacaaacagagccatc
ctgctctcctctggccaggagctctgtgagcggatcaacttccatgtcttggacactgct
gactacgtgaagccagtgaccttctcagtcgagtattccctggaggaccctgaccatggc
cccatgctggacgacggctggcccaccaccctcagagtctcggtgcccttctggaatggc
tgcaatgaggatgagcactgtgtccctgaccttgtgctggatgcccggagtgacctgccc
acggccatggagtactgccagagggtgctgaggaagcctgcgcaggactgctccgcatat
acgctgtccttcgacaccacagttttcatcatagagagcacacgccggcgcgtggcggtg
gaggctacactggagaacaggggcgagaacgcctacagcacggtcctaaatatctcgcag
tcagcaaacctgcagtttgccagcttgatccagaaggaggactcagacggcagcatcgag
tgtgtgaacgaggagaggaggctccagaagaaagtctgcaacgtcagctacccctttttg
cgtgccaaggccaaggtggctttccgtcttgattttgagttcagcaaatccatcttccta
caccacctggagatcgagctcgctgcaggcagtgacagtaacgagcgggacagcaccaag
gaagacaacgtggcccccctacgcttccacctcaaatacgaggctgacgtcctcttcacc
aggagcagcagcctgagccactacgaggtcaagcccaacagctcgctggagagatacgat
ggtatcgggcctcccttcagctgcatcttcaggatccagaacttgggcttgttccccatc
cacgggatgatgatgaggatcaccattcccatcgccaccaggagtggcaaccgcctactg
aagctgagggacttcctcaccgaccaggcgaacacgtcctgtaacatctggggcaacagc
actgagtaccggcccaccccaatggaggaagacttgagtcgtgctccacagctgaatcac
agcaactctgatgtcgtctccatcaactgcaatatacggctggttcccaaccaggaaatc
aatttccatctactggggaacctgtggttgaggtccctaaaagcactcaagtacaaatcc
atgaaaatcatggtcaacgcagccttgcagaggcagttccacagccccttcatcttccgt
gaggaggatcccagccgccagatcgtgtttgagatctccaagcaagaggactggcaggtc
cccatctggatcattgtaggaagcaccctggggggtctcctactgctggccctgctggtc
ctggcactgtggaagctcggcttctttaaaagtgccaggcgcaggagggagcctggtctg
gaccccacccccaaagtgctggagtga

KEGG   Pongo abelii (Sumatran orangutan): 100459915
Entry
100459915         CDS       T01416                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100459915 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100459915 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100459915 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459915 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100459915 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459915 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100459915 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100459915 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100459915 (ITGA3)
   05414 Dilated cardiomyopathy
    100459915 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100459915 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100459915 (ITGA3)
   04515 Cell adhesion molecules [BR:pon04515]
    100459915 (ITGA3)
   04090 CD molecules [BR:pon04090]
    100459915 (ITGA3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100459915 (ITGA3)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100459915 (ITGA3)
CD molecules [BR:pon04090]
 Proteins
  100459915 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N MLANA
Other DBs
NCBI-GeneID: 100459915
NCBI-ProteinID: XP_002834330
UniProt: H2NVM2 A0A6D2XU64
LinkDB
Position
17
AA seq 1051 aa
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYK
DPEDQGNLYIGYTVQVGSAILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFQRKEEVGGAVYVFMNQAGTSFPAHPSLL
LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARPAVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNT
RTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF
EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCQPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRAHCVWLECPIPDAPIVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRT
SIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFK
RARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3156 nt   +upstreamnt  +downstreamnt
atgggccccggccccagccgcgcgccccgcgccccacgcctgatgctctgtgcgctcgcc
ttgatggtggcggccggcggctgcgtcgtctccgccttcaacctggatacccgattcctg
gtagtgaaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacagagcggcagcagcgctacctgctgctggctggtgccccccgggagctcgctgtg
cccgatggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaag
gatgactgtgagcggatgaacatcacagtgaaaagtgaccctggccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggccctgcaggcagagttctggtctgt
gcccaccgctacacccaggtgctgtggtcggggtcagaagaccagcggcgcatggtgggc
aagtgctacgtgcgaggcaatgacctagagctggactccagtgatgactggcagacctac
cacaacgagatgtgcaacagcaacacagactacctggagacgggcatgtgccagctgggc
accagcggtggcttcacccagaacactgtgtacttcggcgcccccggtgcctacaactgg
aaaggaaacagctacatgattcagcgcaaggagtgggacttatctgagtatagttacaag
gacccagaggaccaaggaaacctctatattgggtacacggtgcaggtaggcagcgccatc
ctgcaccccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggcgcg
gtgttcttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggc
tcgcaggtgggcgcctattttggcagcgccattgccctggcagacctgaacaacgatggg
tggcaggacctcctggtgggggctccctactactttcagaggaaagaggaagtagggggt
gccgtctatgtcttcatgaaccaggcgggaacctccttccctgctcacccctcgctcctt
cttcatggccccagtggctccgccttcggcttatctgtggccagcattggtgacatcaac
caggatggatttcaggatattgccgtgggagctccgtttgaaggcttgggcaaagtgtac
atctatcacagtagctctaaggggctcctcagacagccccagcaggtaatccatggagag
aagctgggactgcctggcttggccaccttcggctattccctcagtgggcagatggatgtg
gatgagaacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctg
cgggcccggcccgtcatcaacatcgtccacaagaccttggtggccaggccagctgtgctg
gaccctgcactttgcacggccacctcttgtgtgcaagtggagctgtgctttgcttacaac
cagagtgccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggcc
gacagggaccgccgcccgccccggctccgctttgccggcagtgagtccgctgtcttccac
ggcttcttctccatgccggaaatgcgctgccagaagctggagctgctcctgatggacaac
ctccgtgacaaactccgccccatcatcatctccatgaactattctttacctttgcggatg
cccgatcgcccccggctggggctgcggtccctggacgcctacccgatcctcaaccaggca
caggctctggagaaccacactgaggtccagttccagaaggagtgcgggcctgacaacaag
tgtgagagcaacttgcagatgcgggcagccttcgtgtcagagcagcagcagaagctgagc
aggctccagtacagcagagacgtccggaaactgctcctgagcatcaacgtgacgaacacc
cggacctcggagcgctccggggaggacgcccacgaggcgctgctcaccctggtggtgcct
cccgccctgctgctgtcctcagtgcgcccccctggggcctgccaagctaatgagaccatc
ttttgcgagctggggaaccccttcaaacgcaaccagaggatggagctgctcatcgccttc
gaggtcatcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacg
tcaagtcaccaggacaacctgtggcccatgaccctcactctgctggtggactatacactc
cagacctcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatg
ggcgagtctggcatgaaaactgtggaggatgtaggaagccccctcaagtatgaattccag
gtgggcccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggagtgg
ccctacgaagtcagcaacggcaagtggctgctgtatcccacggagatcaccgtccatggc
aatgggtcctggccctgccaaccacctggagaccttatcaaccctctcaacctcactctt
tctgaccctggggacaggccatcatccccacagcgcaggcggcgacagctggatccaggg
ggaggccagggccccccacctgtcactctggctgctgccaaaaaagccaagtctgagact
gtgctgacctgtgccacagggcgcgcccactgtgtgtggctagagtgccccatccctgat
gcccccattgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcatcgag
gattacagagactttgaccgagtccgagtaaatggctgggctaccctattcctccgaacc
agcatccccaccatcaacatggagaacaagaccacgtggttctccgtggacattgactcg
gagctggtggaggagctgccggccgagatcgagctgtggctggtgctggtggccgtgggt
gcagggctgctgctgctggggctgatcatcctcctgctgtggaagtgcggcttcttcaag
cgagcccgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccag
ccgtcagagacagagaggctgaccgacgactactga

KEGG   Pongo abelii (Sumatran orangutan): 100461052
Entry
100461052         CDS       T01416                                 

Gene name
ITGA10
Definition
(RefSeq) integrin alpha-10 isoform X1
  KO
K06586  integrin alpha 10
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100461052 (ITGA10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100461052 (ITGA10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100461052 (ITGA10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100461052 (ITGA10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100461052 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100461052 (ITGA10)
   05414 Dilated cardiomyopathy
    100461052 (ITGA10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100461052 (ITGA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pon04515]
    100461052 (ITGA10)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100461052 (ITGA10)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 VCBS FG-GAP_2
Other DBs
NCBI-GeneID: 100461052
NCBI-ProteinID: XP_002810364
Ensembl: ENSPPYG00000000932
UniProt: H2N626 A0A6D2XYS3
LinkDB
Position
1
AA seq 1167 aa
MELPLVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGG
FMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREG
RETKTAQAILVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
HAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLERGHRLFPPRMALEDEF
PPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGE
QIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ
PEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPTQRIA
AASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAIS
VVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHRFYMRFTASLDEWTAGARAAFDGSGQ
RLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTSIQ
KLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSATLENRKENAYNT
SLSLIFSRNLHLASLTPQRDSPIKVECAAPSAHARLCSVGHPVFQTGAKVTFLLEFEFSC
SSLLSQVFVKLIASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYETL
PVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCIVQNLT
EPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFK
SLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLLALL
VFCLWKLGFFAHKKIPEEEKREEKLEQ
NT seq 3504 nt   +upstreamnt  +downstreamnt
atggaactccccctcgtcactcacctgttcttgcccctggtgttcctgacaggtctctgc
tccccctttaacctggatgaacatcacccacgcctattcccagggccaccagaagctgaa
tttggatacagtgtcttacaacatgttgggggtggacagcgatggatgctggtgggcgcc
ccctgggatgggccttcaggcgaccggaggggggacgtttatcgctgccctgtagggggg
gcccacaatgccccatgtgccaagggccacttaggtgactaccaactgggaaattcatct
catcctgctgtgaatatgcacctggggatgtctctgttagagacagatggtgatggggga
ttcatggcctgtgcccctctctggtctcgtgcttgtggcagctctgtcttcagttctggg
atatgtgcccgtgtggatgcttcattccagcctcagggaagcctggcacccactgcccaa
cgctgcccaacatacatggatgttgtcattgtcttggatggctccaacagcatctacccc
tggtctgaagttcagaccttcctacgaagactggtagggaaactgtttattgacccagaa
cagatacaggtgggactggtacagtatggggagagccctgtacatgagtggtccctggga
gatttccgaacgaaggaggaagtggtgagagcagcaaagaacctcagtcggcgggaggga
cgagaaacaaagactgcccaagcaatactggtggcctgcacagaagggttcagtcagtcc
catgggggccgacccgaggctgccaggctactggtggttgtcactgatggagagtcccat
gatggagaggagcttcctgcagcactaaaggcctgtgaggctggaagagtgacacgctat
gggattgcagtccttggtcactacctccggcggcagcgagatcccagctctttcctgaga
gaaattagaactattgccagtgatccagatgagcgattcttcttcaatgtcacagatgag
gctgctctgactgacattgtggatgcactaggagatcggatttttggcctcgaagggtcc
catgcagaaaacgaaagctcctttgggctggaaatgtctcagattggtttctccactcac
cggctaaaggatgggattctctttgggatggtgggggcctatgactggggaggctctgtg
ctatggcttgaaagaggtcaccgccttttccccccacgaatggcactggaagacgagttc
ccccctgcattgcagaaccatgcagcctacctgggttactctgtttcttccatgcttttg
cggggtggacgccgcctgtttctctctggggctcctcgatttagacatcgaggaaaagtc
atcgccttccagcttaagaaagatggggctgtgagggttgcccagagcctccagggggag
cagattgggtcatactttggcagtgagctctgcccattggatacagatagggatggaaca
actgatgtcttacttgtggctgcccccatgttcctgggaccccagaacaaggaaacagga
cgtgtttatgtgtatctggtgggccagcagtccttgctgaccctccaaggaacacttcag
ccagaacccccccaggatgctcggtttggctttgccatgggtgctcttcctgatctgaac
caagatggttttgctgatgtggctgtgggggcacctctggaagatgggcaccagggagca
ctgtacctgtaccatggaacccagagtggagtcaggccccatcctacccagaggattgcc
gctgcctccatgccacacgccctcagctactttggccgaagtgtggatggccggctagat
ctggatggagatgatctggtcgatgtggctgtgggtgcccagggggcagccatcctgctc
agctcccggcccattgtccatctgaccccatcactggaggtgaccccacaggccatcagt
gtggttcagagggactgtaggcggcgaggccaagaggcagtctgtctgactgcagccctt
tgcttccaagtgacctcccgtactcctggtcgctgggatcaccgattctacatgaggttc
accgcatcactggatgaatggacggctggggcacgtgcagcatttgatggctctggccag
aggttgtcccctcggaggctccggctcagtgtggggaatgtcacttgtgagcagctacac
ttccatgtgctggatacatcagattacctccggccagtggccttgactgtgacctttgcc
ttggacaataccacaaagccagggcctgtgctgaatgagggctcgcccacctctatacaa
aagctggtccccttctcaaaggattgtggccctgataatgaatgtgtcacagacctggtg
cttcaagtgaatatggacatcagaggctccaggaaggccccatttgtggttcgaggtggc
cggcggaaagtgctggtatctgcaactctggaaaacagaaaggaaaatgcttacaatact
agcctgagtctcatcttctctagaaacctccacctggccagtctcactccccagagagac
agcccaataaaggtggaatgtgcagccccttctgctcatgcccggctctgcagtgtgggg
catcctgtcttccagactggagccaaggtgacctttctgctagagtttgagtttagctgc
tcctctctcctgagccaggtcttcgtgaagctgattgccagcagtgacagcctggagaga
aatgggacccttcaagataacacagcccagacctcagcctacatccaatatgagccccac
ctcctgttctctagtgagtctaccctgcaccgctatgaggttcacccatatgagaccctc
ccagtgggtcctggcccagaattcaaaaccactcttagggttcagaacctaggctgctat
gtggtcagtggcctcatcatctcagccctccttccagctgtggcccatgggggcaattac
ttcctatcactgtctcaagtcatcactaacaatgcaagctgcatagtgcagaacctgact
gaacccccaggcccacctgtgcatccagaggagcttcaacacacaaacagactgaatggg
agcaatactcagtgtcaggtggtgaggtgccaccttgggcagctggcaaaggggaccgag
gtctctgttggactattgaggctggttcacaatgaatttttccgaagagccaagttcaag
tccctgacagtggtcagcacctttgagctgggaaccgaagagggcagtgtcctacagctg
actgaagcctcccgttggagtgagagcctcttggaggtggttcagacccggcctatcctc
atctccctgtggatcctcataggcagtgtcctgggagggttgctcctgcttgctctcctt
gtcttctgcctgtggaagcttggcttctttgcccataagaaaatccctgaggaagaaaaa
agagaagagaagttggagcaatga

DBGET integrated database retrieval system