KEGG   Pongo abelii (Sumatran orangutan): 100434127
Entry
100434127         CDS       T01416                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04114  Oocyte meiosis
pon04210  Apoptosis
pon04218  Cellular senescence
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04621  NOD-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100434127 (ITPR3)
   04020 Calcium signaling pathway
    100434127 (ITPR3)
   04070 Phosphatidylinositol signaling system
    100434127 (ITPR3)
   04022 cGMP-PKG signaling pathway
    100434127 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100434127 (ITPR3)
   04210 Apoptosis
    100434127 (ITPR3)
   04218 Cellular senescence
    100434127 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100434127 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100434127 (ITPR3)
   04621 NOD-like receptor signaling pathway
    100434127 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    100434127 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    100434127 (ITPR3)
   04922 Glucagon signaling pathway
    100434127 (ITPR3)
   04929 GnRH secretion
    100434127 (ITPR3)
   04912 GnRH signaling pathway
    100434127 (ITPR3)
   04915 Estrogen signaling pathway
    100434127 (ITPR3)
   04921 Oxytocin signaling pathway
    100434127 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    100434127 (ITPR3)
   04918 Thyroid hormone synthesis
    100434127 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    100434127 (ITPR3)
   04924 Renin secretion
    100434127 (ITPR3)
   04925 Aldosterone synthesis and secretion
    100434127 (ITPR3)
   04927 Cortisol synthesis and secretion
    100434127 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100434127 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    100434127 (ITPR3)
   04971 Gastric acid secretion
    100434127 (ITPR3)
   04972 Pancreatic secretion
    100434127 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100434127 (ITPR3)
   04725 Cholinergic synapse
    100434127 (ITPR3)
   04728 Dopaminergic synapse
    100434127 (ITPR3)
   04726 Serotonergic synapse
    100434127 (ITPR3)
   04720 Long-term potentiation
    100434127 (ITPR3)
   04730 Long-term depression
    100434127 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    100434127 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    100434127 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    100434127 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100434127 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100434127 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100434127 (ITPR3)
   05012 Parkinson disease
    100434127 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    100434127 (ITPR3)
   05017 Spinocerebellar ataxia
    100434127 (ITPR3)
   05020 Prion disease
    100434127 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    100434127 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100434127 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100434127 (ITPR3)
   05163 Human cytomegalovirus infection
    100434127 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100434127 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100434127 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pon04040]
    100434127 (ITPR3)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100434127 (ITPR3)
Ion channels [BR:pon04040]
 Ligand-gated channels
  IP3 receptor
   100434127 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 100434127
NCBI-ProteinID: XP_024103829
Ensembl: ENSPPYG00000016504
LinkDB
Position
6
AA seq 2671 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFREKGSEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIRTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEEPGGKNVRRSIQGVGHMMSTMVLSRKQSVFSAPSMSAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FESFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAILLPMDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPMGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQS
NEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSVPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPNNHSTVSPLGMPHGAAAFVDTCSGDKMDCVSGVSVPEVLEEDGELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8016 nt   +upstreamnt  +downstreamnt
atgagtgaaatgtccagctttcttcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagccc
gcagccggggacctggacaacccccctaagaagttccgagactgcctcttcaaggtgtgc
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagactaagcaggac
aaggagaagatcgctgacgtggtattgctgcagaagctgcagcacgcggcgcagatggag
cagaagcaaaacgacacggagaacaagaaggtgcacggggatgtcgtgaagtatggcagt
gtgatccagctcctgcacatgaagagcaacaagtacctgacagtgaacaagcggcttccg
gccttgctggagaagaacgccatgcgggtgactctggatgccacaggcaacgagggttcc
tggctcttcatccaacccttttggaagctgcggagcaacggggacaacgtggtcgtgggg
gacaaggtgatcctgaatcctgtcaatgccgggcagcctctgcatgccagcaattatgag
ctcagcgacaacgccggctgcaaggaggtcaactctgtgaactgcaataccagctggaag
atcaacctgtttatgcagtttcgggaccacctggaggaggtgttgaaagggggagacgtg
gtgcggctgttccatgcggagcaggagaagttcctgacgtgtgacgagtacaagggcaag
ctgcaggtgttcctgcgaaccacactgcgccagtctgccacctcggccaccagctccaat
gctctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctgggcactgg
aatggcctgtaccgcttcaagcacctggctacgggcaactacctggctgctgaggagaac
cccagttacaaaggtgatgcctcggatcccaaggcagcaggaatgggggcccagggccgt
gcaggccgcaggaatgctggggagaagatcaagtaccgcctggtggctgtgcctcatggc
aacgacatcgcctctctctttgagctggaccctaccaccttgcagaaaaccgactctttc
gtgccccggaactcgtacgtccggctgcggcacctttgcaccaacacgtggatccagagc
accaatgtgcccattgacatcgaggaggagcggcccatccggctcatgctgggcacctgc
cccaccaaggaggacaaggaggcctttgccatcgtgtcagtgcccgtgtccgagatccga
gacctggactttgccaatgacgccagctccatgctggccagcgccgtggagaaactaaac
gagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggaagacctggtg
ttctttgtcagcgatgtccccaataatgggcagaatgtcctggacatcatggtcactaag
cccaaccgggaacggcagaagctgatgagggagcagaacatcctcaaacagatctttggc
attctgaaggccccgttccgtgagaaggggagcgaaggtcccctggtgcggctggaggag
ctgtcagaccagaagaacgccccctaccagcacatgttccgcctgtgctaccgcgtgctg
cggcattcccaggaggactaccgcaagaaccaggagcacatcgccaagcagtttgggatg
atgcagtcccagattggctatgacatcctggccgaggacaccatcaccgccctgctgcac
aacaaccgcaaactccttgaaaagcacatcaccaagactgaggtggagaccttcgtcagc
cttgtgcgcaagaaccgggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacattgccatccccgtcacccaagagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatccggaccgaacttcggcctgtgaaggagatggcccaatcccat
gagtacctgagcatcgagtactcagaagaggaagtgtggctcacgtggactgacaagaat
aacgagcatcatgagaagagtgtgaggcagctggcccaggaggcgcgggccggcaacgcc
cacgacgagaatgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ttggaccgccagtacttggccatcgatgagatctcccagcagctgggcgtggacctgatt
ttcctgtgcatggcagacgagatgctgccctttgacctgcgcgcctccttttgccacctg
atgctgcatgtgcacgtggaccgtgacccccaggagctggtcacgccggtcaagtttgcc
cgtctctggactgagatccccacagccataaccatcaaggactatgattccaacctcaac
gcgtcccgagatgacaagaagaacaagtttgccaacaccatggagttcgtggaggactat
ctcaacaatgtggtcagcgaggccgtgccctttgccaacgaggagaagaacaagctcact
tttgaggtggtcagcctggcgcacaatctcatctacttcggcttctacagcttcagcgag
ctgctgcggctcactcgcacactgctgggcatcatcgactgtgtgcaggggcccccggcc
atgctgcaggcctatgaggaaccgggcggcaagaacgtgcggcggtccatccagggcgtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtccgtcttcagtgcccccagc
atgtctgctggggccagtgctgctgagccgctggacagaagcaagtttgaggagaatgag
gacattgtggtgatggagaccaagctgaagatcctggaaatccttcagttcatcctcaat
gtccgcctggattaccgcatctcctatctgctgtctgtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagcggggctgatggcacagcccctgccttcgactctaccact
gccaacatgaacctggatcgcatcggggagcaggcggaggccatgtttggagtggggaag
acgagcagcatgctggaggtggacgacgagggcgggcgcatgttcctgcgcgtgctcatc
cacctcaccatgcacgactatgcgccgctggtctcgggtgccctgcagctgctcttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggttcagctgctgatctca
gcgcaggatgtggagaactacaaggtgatcaagtcggagttggaccggcttcggaccatg
gtggagaagtcagagctgtgggtggacaagaagggcagcggcaagggcgaggaggtggag
gcaggtgccgctaaggacaagaaggaacggcccacggatgaagagggctttctgcaccca
ccaggggagaaaagcagtgagaactaccagatcgtcaagggcatcctggaaaggctgaac
aagatgtgcggggtcggggagcaaatgaggaagaagcagcaacggctgctgaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctacgacaagggtgatgccaag
atgatggagatcctgcgctacacgcaccagttcctgcagaagttctgtgcggggaacccc
ggcaaccaggccctgctgcacaagcacctgcacctcttcctcacgccggggctcctggag
gcagagaccatgcagcacatcttcctgaacaactatcagctctgctccgagatcagtgag
cctgtgttgcagcacttcgtgcacctgctggccacgcacgggcgccatgtgcagtacctg
gacttcctgcacaccgtcatcaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaatgcaggtgacgatgtggtcgtgttctacaatgataaggca
tcgctggcccacctgctggacatgatgaaggccgcccgcgacggcgtggaggaccacagc
cccctcatgtaccacatttccctggtggacctgctggccgcctgtgccgagggcaaaaac
gtctacaccgagatcaagtgcacctccctgctgccgctggaggacgtggtgtctgtggtg
acgcatgaggactgcatcaccgaggtgaaaatggcatacgtgaacttcgtgaaccactgc
tacgtggacacggaggtggagatgaaggagatctacaccagcaaccacatctggacgctc
tttgagagcttcaccctggacatggctcgggtctgcagcaagcgtgagaagcgcgtggct
gaccccaccctggagaagtacgtgctgagcgtcgtgctggacaccatcaacgccttcttc
agctccccattctctgagaacagcacttccctgcagacacaccagacgattgtggtgcag
ctgctgcagtccaccacacgcctcctcgagtgtccgtggctacagcagcagcacaagggc
tccgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatcttgttg
cccatggacctggacgcccacatcagctcgatgctcagcagtggagccagctgtgcagct
gccgcccagcggaacgcctccagctacaaggcaaccacgcgcgccttcccccgcgtcacc
cccaccgccaaccagtgggactacaagaacatcatcgagaagctgcaggacatcatcaca
gccctggaggagcggctgaagcccctggtacaggctgagctgtccgtgctggtggatgtc
ctgcactggcctgagctgctcttcctggaaggcagtgaggcctaccagcgctgcgagagt
gggggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcggaggagaag
ctgtgcatcaaggtgctgcggaccctgcagcagatgctgctcaagaagaccaagtacggg
gaccggggcaaccagctgcgtaagatgctgctgcaaaactacctccagaaccggaagtcc
acctcgcggggggaccttcccgaccccatgggcactggcctggacccagactggtcggcg
atcgcggccacccagtgccggctggacaaggagggggccaccaagttggtatgcgacctc
atcaccagcaccaagaacgagaagatcttccaggagagcatcggcctggccatccgcctg
ctggatggtggcaacacagagatccagaaatccttccacaacttgatgatgagtgacaag
aagtcagagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccagcaggagacc
aagtccacggtggcagtcaacatgaacgacctgggcagccagccacatgaggaccgcgag
ccagtcgaccccacgaccaaaggccgcgtggcctccttctcgatacctggctcctcatcc
cgctactcgctgggccccagcctgcgccgggggcacgaggtgagcgaacgtgtgcagagc
aacgagatgggcacatccgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgcgagaaccacaaccgggacctgcagaacttcctgcgctgtcagaacaacaaaaccaac
tacaacttggtgtgcgagacgctgcagttcctggacatcatgtgcggcagcaccacgggc
ggcctggggctgctggggctctacatcaatgaggacaacgtgggcctcgtcatccagacc
ttggagaccctcactgagtactgccagggcccctgccatgagaaccagacctgcattgtg
acgcacgaatccaatggcatagacatcatcaccgcactgatcctcaatgacatcagcccc
ctgtgcaagtaccgcatggatctggtgctgcagctcaaggacaatgcctccaagctgctc
ctggctctgatggagagccggcatgacagtgaaaatgctgagcgcatcctcatcagcctg
cggccccaggagctggtggatgtcatcaagaaggcctacctgcaggaggaagagcgtgag
aactcagaggtgagcccacgtgaagtgggccataacatctacatcctggcgctgcagctc
tccaggcacaataaacagctgcagcacctgctgaagccggtgaagcgcattcaagaggag
gaggctgagggtatctcttccatgctcagcctcaacaacaagcagctgtcacagatgctc
aagtcctcagtgccggcacaggaggaggaggaagaccccctggcctactacgagaaccac
acgtcccagatcgagattgtgcggcaggaccgcagcatggagcagatcgtgttcccagtg
cccggcatctgccagttcctgacggaggaaaccaagcaccggctcttcaccactaccgag
caggacgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttcctgcacaac
gagatggagtggcagcgcaagctccgcagcatgccgctgatctactggttctcccgccgc
atgaccctgtggggcagcatctccttcaacctggccgtgtttatcaacatcatcattgcc
ttcttctacccttacatggagggcgcgtccacaggcgtgctggactcccctctcatctca
ctgctcttctggatcctcatctgcttctccattgcggccctgttcaccaagcgctacagc
atccgccccctcatcgtggcactcatcctgcgctccatctactatctgggcatcgggccc
acgctcaacatcctgggtgccctcaatctgaccaacaagatcgtgtttgtggtgagcttc
gtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggacatggaattt
ctctaccacgtgggctacatcctgaccagtgtcctgggcctctttgctcatgagttgttc
tacagcatcctgctctttgacctcatctaccgcgaggagacgctgttcaacgtcatcaag
agtgtgacccgcaatggccgctccatcctgctgacagccctgctggccctcatcctggtc
tacctcttctccatcgtcggcttcctcttcctcaaggatgacttcattctcgaggtcgac
cggctgcccaacaaccactccacagtcagccccctggggatgccacatggagctgctgca
tttgtggacacctgcagtggggacaagatggactgtgtctcgggggtctcagtgcccgag
gtcctggaagaggacggggagctggacagcacagagcgggcctgtgacactctgttgatg
tgcatcgtcactgtcatgaaccatgggctacgcaacggtggtggcgtgggcgacattctc
cgcaagccctccaaagatgagtctctcttcccagcccgagtggtctatgacctcctgttc
ttcttcatcgtcatcatcatcgtgctgaacctcatctttggggtaatcatcgacaccttc
gctgacctgcgtagtgagaagcagaagaaggaggagattcttaagacgacatgcttcatc
tgtggtctggagagggacaagtttgataacaagacggtgtcatttgaggaacacatcaag
ctggagcacaacatgtggaactacttgtacttcattgtgctggtccgtgtgaagaacaag
accgactacacaggccccgagagctacgtggcccagatgatcaagaacaagaaccttgac
tggttcccccggatgcgggccatgtcccttgtcagcaacgagggcgagggggagcagaac
gagattcggattctccaggacaagctcaactccaccatgaagctggtgtcccacctcact
gcccagctcaacgagctcaaggagcagatgacggagcagcggaaacgcaggcaacgccta
ggttttgtggatgtccagaactgcatgagccgctga

KEGG   Pongo abelii (Sumatran orangutan): 100434318
Entry
100434318         CDS       T01416                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2 isoform X1
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04114  Oocyte meiosis
pon04210  Apoptosis
pon04218  Cellular senescence
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04621  NOD-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100434318 (ITPR2)
   04020 Calcium signaling pathway
    100434318 (ITPR2)
   04070 Phosphatidylinositol signaling system
    100434318 (ITPR2)
   04022 cGMP-PKG signaling pathway
    100434318 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100434318 (ITPR2)
   04210 Apoptosis
    100434318 (ITPR2)
   04218 Cellular senescence
    100434318 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100434318 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100434318 (ITPR2)
   04621 NOD-like receptor signaling pathway
    100434318 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    100434318 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100434318 (ITPR2)
   04929 GnRH secretion
    100434318 (ITPR2)
   04912 GnRH signaling pathway
    100434318 (ITPR2)
   04915 Estrogen signaling pathway
    100434318 (ITPR2)
   04921 Oxytocin signaling pathway
    100434318 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    100434318 (ITPR2)
   04918 Thyroid hormone synthesis
    100434318 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    100434318 (ITPR2)
   04924 Renin secretion
    100434318 (ITPR2)
   04925 Aldosterone synthesis and secretion
    100434318 (ITPR2)
   04927 Cortisol synthesis and secretion
    100434318 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100434318 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    100434318 (ITPR2)
   04971 Gastric acid secretion
    100434318 (ITPR2)
   04972 Pancreatic secretion
    100434318 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100434318 (ITPR2)
   04725 Cholinergic synapse
    100434318 (ITPR2)
   04728 Dopaminergic synapse
    100434318 (ITPR2)
   04726 Serotonergic synapse
    100434318 (ITPR2)
   04720 Long-term potentiation
    100434318 (ITPR2)
   04730 Long-term depression
    100434318 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    100434318 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100434318 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100434318 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100434318 (ITPR2)
   05012 Parkinson disease
    100434318 (ITPR2)
   05017 Spinocerebellar ataxia
    100434318 (ITPR2)
   05020 Prion disease
    100434318 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    100434318 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100434318 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100434318 (ITPR2)
   05163 Human cytomegalovirus infection
    100434318 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100434318 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pon04040]
    100434318 (ITPR2)
Ion channels [BR:pon04040]
 Ligand-gated channels
  IP3 receptor
   100434318 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 100434318
NCBI-ProteinID: XP_024112506
Ensembl: ENSPPYG00000004374
LinkDB
Position
12
AA seq 2701 aa
MTDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKTVRDGDPPTSRKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSANGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGE
IGESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEHQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGNTLRKILLNRYFKGDYSIGMNGHLSGAYSKTAQVGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLK
EGMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSILFF
FSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPAMTLTTMMEACAKENCSPT
IPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
NT seq 8106 nt   +upstreamnt  +downstreamnt
atgactgataaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcagcaccttggggttagtggatgacagatgtgtggtgcac
ccagaggccggggaccttgccaaccctcccaagaagtttagagactgccttttcaaggtg
tgccctatgaacagatattctgcccagaagcaatattggaaagcaaagcaagccaaacaa
gggaaccacactgaggcagccttgctgaagaaactacagcatgctgcagaactggaacaa
aaacaaaatgaatcagagaataagaaactgttgggagaaattgtgaaatacagtaatgtt
atacaactactgcatataaaaagcaacaaatatcttactgtcaacaagagattacctgct
ttactggagaagaatgccatgcgtgtgtccttggatgctgcaggaaatgaagggtcttgg
ttttatattcatcccttctggaagctgagaagcgagggtgacaatattgttgtaggagat
aaagttgttttgatgcctgtgaatgcagggcagccactacatgccagcaacatagagctt
cttgataacccagggtgtaaagaggtgaatgctgttaattgcaacaccagctggaaaatc
actttattcatgaaatatagttcctatcgagaggatgtattaaaaggaggggacgttgtt
agattgtttcatgcggaacaagagaagtttttgacttgtgatgaatatgagaaaaaacag
cacattttccttcgtacgaccttgcgccaatcagctacttctgctactagttctaaagca
ctctgggaaatagaggtggttcatcatgacccatgccgtgggggtgcaggacagtggaac
agcttgttcagatttaagcatcttgcaactggaaactatttagctgcagagcttaatcct
gattatcgagatgcccaaaatgaaggaaaaactgtgagagatggagaccctccaacttca
aggaaaaagcgccaggcaggagagaagatcatgtatactttggtttcagtcccgcatggc
aatgacattgcatccctttttgaactagatgccacaactcttcagagagctgactgcctg
gttccaaggaactcatatgttcggttaaggcatttatgcaccaacacatgggtaaccagt
actagtatccccatagacacagatgaagagaggcctgttatgttaaagattggaacctgc
caaaccaaagaagataaagaagcgttcgcaattgtgtctgttccactgtctgaagttcga
gacttagactttgccaatgatgccaataaagtactagcgaccacagttaaaaagctagaa
aatggcacaataactcagaatgaaaggagatttgtaaccaaattattggaagacctcatc
ttctttgttgctgatgtgcctaataatggacaagaagttctggatgtggttatcactaag
ccaaaccgagagcgtcaaaaattgatgagggaacaaaacatactggcacaggtatttgga
attcttaaagcaccctttaaggagaaagcaggagaaggctcaatgctaagacttgaagat
ctgggggatcaaagatatgcaccctacaagtacatgctgcggctctgttaccgcgtcctg
agacactcgcagcaggattaccggaaaaatcaggaatatattgctaagaatttctgtgtc
atgcagtcccagattggctatgatattttggcagaagatactatcacagctttgttgcac
aacaacagaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagt
ttactcaggagaaatcgggagccaaggtttttggattatttgtcagatctgtgtgtgtct
aataccactgctatccctgtaactcaagaactcatctgtaaatttatgttgagtccaggc
aatgcagacattctcattcaaactaaggtggtctcaatgcaagcagacaaccccatggag
agctccatcctttcggatgacattgatgatgaagaagtttggctctattggattgacagc
aacaaggaaccacatggcaaagctatcaggcaccttgctcaagaggcaaaagaaggcacc
aaagctgacttagaagttcttacctattacaggtaccagctaaacctctttgcaaggatg
tgcttggatcgccagtatctggccataaaccagatttctacacagctctctgtagacctg
atcctgcggtgtgtgtcggatgagagcctgccgttcgacctccgagcgtccttctgtcgc
ctcatgcttcacatgcacgttgaccgggatccccaagagtccgtggtgcctgttcgctat
gccaggctctggacagaaatccccacaaagatcacaattcatgaatatgattctataaca
gactcttccagaaatgatatgaagaggaaatttgccttgacaatggaatttgttgaagaa
tatttgaaagaagttgtaaaccagccctttccttttggggataaagaaaaaaataaactg
acatttgaggtggtccacttggctcggaatcttatatactttggattttatagtttcagt
gagttattaaggctaacaagaacacttctggctattttagacattgtacaggcccccatg
tcatcatactttgaaagattaagcaaatttcaagatggaggaaacaatgtgatgagaacc
attcatggtgtgggagagatgatgacccagatggtactcagtagaggctccatcttcccc
atgagcgtgccagatgtgccacccagcatccacccgagcaagcaagggagccccaccgag
catgaggatgtgactgtgatggacaccaagctgaagatcattgagattttgcagtttatc
ctgagtgtcagactagattataggatctcatatatgctgtcaatatataagaaggagttt
ggagaggacaatgacaatgcagagacatctgccaatggatctccagacactttactacca
tcagctattgttcctgatatagatgaaattgcagctcaggcagaaactatgtttgcggga
agaaaggaaaaaaacccagttcaacttgacgatgaaggaggcaggacgtttttacgggtc
ctcattcatctcatcatgcacgactacccgcctttgctgtctggagccctgcagctgttg
tttaagcacttcagccagagggcggaggttttacaggcatttaagcaggtgcaattactg
gtgtctaatcaagacgtagataactacaagcaaatcaaggcagatctagaccagcttcga
ctgacagtagaaaagtctgagctatgggttgagaagagcagcaactatgagaatggagaa
ataggggaaagtcaagtgaaaggtggtgaagagccaattgaggaatcgaacattttaagt
ccagtgcaggatggaacaaagaaacctcagattgacagcaacaaaagcaataactaccgg
attgtaaaggagattttgatcaggctaagtaaactctgtgtacagaataaaaagtgtcgg
aatcaacatcaacgattactgaaaaatatgggggcgcattcggtggtgttggatcttctg
cagataccctacgaaaagaatgatgaaaagatgaatgaagtaatgaatctagcccataca
tttctgcagaatttctgtcgaggaaatccacagaatcaagttcttcttcataaacatctg
aatttgtttttaactccaggtctccttgaagcagaaaccatgaggcacatcttcatgaac
aattaccatctgtgcaacgaaattagcgagagagttgtacaacactttgtgcactgcatt
gagacacatggccgccacgtggagtacctgaggtttttgcaaacaattgtaaaagcagat
ggtaaatatgtgaagaaatgccaggatatggtaatgacagagttgataaatgggggtgaa
gacgtgctgatattttacaatgatagagcatcatttccaatccttctccatatgatgtgt
tcagagagagaccgaggggatgagagtggccccttagcctaccacatcaccctggtggaa
ttgctggcagcatgcacagaggggaaaaatgtctacactgaaatcaagtgtaattccctt
ctcccactggacgacatagtgagggtggtgacccatgacgactgcatccctgaggttaaa
attgcttatgtgaactttgttaatcactgttatgttgacactgaagtggaaatgaaagaa
atctatacaagtaaccacatttggaaattatttgagaacttcttggtggatatggcaagg
gtttgcaacacaactacagacaggaaacatgcagacatctttttggaaaagtgtgtgact
gagtcaataatgaatattgtgagcggcttctttaattctcccttttcagacaatagtacc
agcctccagacacatcagccagtttttattcagctactgcaatctgccttcagaatttac
aattgcacctggccaaacccagcgcagaaagcctcggtggaatcctgtatcagaactttg
gctgaagtagcaaaaaatcgtggaattgccattccagtggatttggacagccaagttaat
actcttttcatgaagagccattcaaatatggtgcagagagcagcaatgggttggagactg
tcagctcgctctgggccacgctttaaggaagctcttggagggcctgcttgggattacaga
aatattattgaaaagttacaggatgtcgtggcctccttggagcaccagttcagcccaatg
atgcaggctgaattctcagtgttggttgatgtattgtacagtccagaactgctgttccct
gagggaagcgatgcaagaataagatgtggcgctttcatgtcgaagttgattaatcataca
aagaaactaatggagaaagaagaaaaactgtgcattaaaattcttcagacattacgagaa
atgttagagaagaaagacagctttgtggaagagggtaacacattaagaaagatacttctg
aatcgatactttaaaggtgattatagtattggtatgaatggacacctatcaggagcctac
tccaaaactgcacaggtgggaggaagcttttctggacaagactcagataagatggggata
tcaatgtcagacattcagtgtctgctggataaagaaggtgcatcagaacttgtcatcgat
gttatagtgaacaccaaaaatgacagaattttttcagaaggcattttcctcggcattgcc
ttgcttgaaggaggaaatacacaaacacagtattctttctaccagcagttgcatgaacaa
aaaaagtcagaaaaattctttaaagttctctatgatcgaatgaaggctgctcagaaagaa
ataagatcaacagtgacagttaataccatagatttaggtaacaaaaaaagggacgatgac
aatgaattgatgacatctggtccacgaatgagagtaagagattcaacactacatttaaaa
gagggaatgaaagggcaattaacagaggcttcttcagcaacatccaaagcatattgtgta
tacagaagagaaatggatccagaaatagacattatgtgcacaggaccagaagcgggaaac
actgaggaaaaatctgcagaggaagtaacaatgagtcctgcaattgccatcatgcagcca
atactgagatttcttcagttactgtgtgagaatcacaaccgggaattgcagaacttcttg
aggaatcaaaacaacaaaacaaattacaaccttgtctgtgagacccttcagtttctggac
tgcatttgtggaagtacaaccggtggcctgggcctgttgggtctctacatcaatgagaag
aacgtggcgctggtcaaccagaccctggagagcttgactgagtattgccagggcccttgc
catgaaaatcagacctgtatcgctacacatgagtctaatgggattgatatcatcattgct
ttgattctgaatgacataaaccctcttggtaaataccgaatggacctggtgctccagcta
aagaacaatgcatctaaacttttgctggccattatggaaagcagacatgacagcgagaat
gcagaaagaattctttttaacatgagacccagagaactggtggatgtgatgaagaatgcc
tacaaccaaggattggaatgtgaccatggggatgacgaaggtggagatgatggtgtttct
ccgaaagatgttggacacaatatctatattctggcccatcagttggcccgccacaataaa
ctattgcagcagatgctcaaaccaggatcggatccagatgaaggagatgaagccttaaag
tattatgccaaccacactgcacagattgagattgtccggcatgataggaccatggaacaa
atagtttttcctgtccccaatatatgtgaatacctcactcgagaatccaagtgccgtgtg
ttcaatacaactgaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaaca
gaagatctctacaatgaaatgaagtggcagaagaaaatcaggaataaccctgcactgttc
tggttctcgaggcacatctctctctgggggagcatttccttcaacctggctgtgttcatc
aatttagctgttgctctcttctacccatttggggatgatggcgatgaaggtacactttct
ccattgttctcggttcttctttggatagcagttgcgatctgcacatctatactgtttttc
ttctccaagcctgtgggtattcggccatttcttgtatcaataatgctcagatcaatatat
acaataggtcttgggcctacattaatacttcttggtgcagctaatctttgtaataaaatt
gtatttctggtgagttttgttggaaatcgtggcacgttcacccgtgggtaccgagcagtc
atcctggatatggcctttctctatcacgtggcgtatgtcctggtttgcatgctgggcctt
tttgtccatgaattcttctatagcttcctgctttttgatttggtgtacagagaagagact
ttgctgaatgtcataaaaagtgtcacacgaaatggccgctctattattctaactgcagtc
ctggctctcatcctcgtctacctgttttccattattgggttcctttttttgaaggatgac
ttcactatggaagttgataggctgaaaaaccgaactcctgttacaggcagtcatcaagtg
cctgctatgactttaactaccatgatggaagcatgtgccaaggagaactgttcacccaca
attccagcttcaaatacagctgatgaagagtatgaagatggaattgaaaggacgtgtgac
actctccttatgtgcattgtcaccgtgctgaatcagggcctcaggaatggcggtggtgtg
ggggatgtgctaagaaggccatcgaaagatgagcccttgtttgctgcccgagtggtttat
gaccttcttttttatttcattgttatcattattgttctgaacttgatttttggtgttatc
atcgatacttttgctgatctcagaagcgaaaaacagaaaaaagaagaaattctaaagaca
acttgtttcatctgtggacttgagagagacaagtttgataacaaaacagtttcatttgag
gagcacattaagtcagaacacaatatgtggcattatttgtacttcatagtcctggtgaaa
gttaaagacccaacagaatacactggacctgaaagttacgtggctcaaatgattgtggag
aagaatttggattggtttcctcggatgcgagccatgtccctcgtcagcaatgaaggcgac
agtgagcaaaatgaaattcggagccttcaggagaagttggaatcgaccatgagtctggtc
aaacagctgtcgggtcagctggcggagctcaaggagcagatgacagaacaaaggaagaat
aagcagagactgggcttcctcggatcaaacacaccccatgtgaatcatcacatgccacca
cactga

KEGG   Pongo abelii (Sumatran orangutan): 100445922
Entry
100445922         CDS       T01416                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1 isoform X1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04210  Apoptosis
pon04218  Cellular senescence
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04621  NOD-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100445922 (ITPR1)
   04020 Calcium signaling pathway
    100445922 (ITPR1)
   04070 Phosphatidylinositol signaling system
    100445922 (ITPR1)
   04022 cGMP-PKG signaling pathway
    100445922 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100445922 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100445922 (ITPR1)
   04210 Apoptosis
    100445922 (ITPR1)
   04218 Cellular senescence
    100445922 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100445922 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100445922 (ITPR1)
   04621 NOD-like receptor signaling pathway
    100445922 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    100445922 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100445922 (ITPR1)
   04929 GnRH secretion
    100445922 (ITPR1)
   04912 GnRH signaling pathway
    100445922 (ITPR1)
   04915 Estrogen signaling pathway
    100445922 (ITPR1)
   04921 Oxytocin signaling pathway
    100445922 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    100445922 (ITPR1)
   04918 Thyroid hormone synthesis
    100445922 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    100445922 (ITPR1)
   04924 Renin secretion
    100445922 (ITPR1)
   04925 Aldosterone synthesis and secretion
    100445922 (ITPR1)
   04927 Cortisol synthesis and secretion
    100445922 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100445922 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    100445922 (ITPR1)
   04971 Gastric acid secretion
    100445922 (ITPR1)
   04972 Pancreatic secretion
    100445922 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100445922 (ITPR1)
   04725 Cholinergic synapse
    100445922 (ITPR1)
   04728 Dopaminergic synapse
    100445922 (ITPR1)
   04726 Serotonergic synapse
    100445922 (ITPR1)
   04720 Long-term potentiation
    100445922 (ITPR1)
   04730 Long-term depression
    100445922 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    100445922 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100445922 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100445922 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100445922 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100445922 (ITPR1)
   05012 Parkinson disease
    100445922 (ITPR1)
   05016 Huntington disease
    100445922 (ITPR1)
   05017 Spinocerebellar ataxia
    100445922 (ITPR1)
   05020 Prion disease
    100445922 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    100445922 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100445922 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100445922 (ITPR1)
   05163 Human cytomegalovirus infection
    100445922 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100445922 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100445922 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pon04040]
    100445922 (ITPR1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100445922 (ITPR1)
Ion channels [BR:pon04040]
 Ligand-gated channels
  IP3 receptor
   100445922 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 100445922
NCBI-ProteinID: XP_009237048
Ensembl: ENSPPYG00000013697
LinkDB
Position
3
AA seq 2719 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAA
PEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSE
TSSGNSSQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSE
LWVYKGQGPDETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQE
SASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQ
NQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIK
FLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSP
LMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCY
VDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFF
SSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAI
PVDLDSQVNNLFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSAL
EDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKL
CIKVLQTLREMMTKDRGYGEKGEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPS
KPGGGGGGSGSSSMSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIAL
LEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEV
DRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATAD
KTKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCIC
GSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALIL
NDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQ
GEVEFEDGENGEDGAASPRNVGHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAK
HTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLF
NEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSG
LLWTAMLISLAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMS
FVGNCGTFTRGYRAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVI
KSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEF
LFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGD
VLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTC
FICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERN
LDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQ
RIGLLGHPPHMNVNPQQPA
NT seq 8160 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagcttcctacatattggagacatttgttctctgtacgcggag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaaaccggagaccttaacaatccacctaagaaattcagagactgcctctttaagcta
tgtcccatgaaccgctactctgcccaaaagcagttctggaaagccgctaagcctggggcc
aacagcacaacagacgcagtgctactcaacaaactgcaccacgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggcttcctgct
ctgttggagaagaatgccatgagagtcacattggacgaggctggaaatgaagggtcctgg
ttttatattcagccattctacaagctgcgatccattggagacagcgtggtcataggtgac
aaggttgttctgaaccccgtcaatgctggtcagcccctacatgctagcagccatcaactg
gtagataacccaggctgcaatgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagatgacatattaaaggggggtgacgtggtg
aggctgtttcatgctgagcaggagaagtttctcacctgtgacgaacacaggaagaagcag
catgtcttcctgagaaccacgggccggcagtcggccacatctgccaccagttcaaaagcc
ttgtgggaggtggaggtggtccagcatgatccatgtcggggcggagcagggtattggaac
agccttttccgtttcaagcacctggccacgggacattacttggcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtagaccctgatcaggatgcctct
cgaagtaggttgcggaatgcccaagaaaagatggtgtactccctggtctctgtgcctgaa
ggcaatgacatctcctccatttttgagctagaccccactactctccgtggaggtgacagc
cttgtcccaaggaactcttatgttcggctcagacacctatgtactaatacctgggttcac
agcacaaatattcctattgacaaggaagaagaaaagcccgtgatgctgaaaattggcacc
tctcctgtgaaggaggataaggaagcatttgccatagttccagtttctcctgctgaagtt
cgggacctggactttgccaatgatgccagcaaggtgctgggctccattgctgggaagcta
gagaaaggcaccatcacccagaatgaaaggaggtctgtaaccaagctgctagaagatttg
gtttacttcgtcactggcggaactaattctggtcaagatgttcttgaagttgtcttctcc
aagcccaacagagaacggcagaaactgatgagagaacagaatattctcaagcagatcttc
aagttgttacaagccccattcacagactgcggcgatggcccaatgcttcggctggaagag
ctcggggaccagcggcacgctcctttcagacacatctgccggctctgctacagggtgctg
agacactcgcagcaagactacaggaagaaccaggagtatatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgttggctgaagacactatcactgccctgctccac
aataatcggaaactcctggaaaaacacattaccgcggcagagattgacacatttgtcagc
ctggtgcgaaagaacagggagcccagattcttagattacctctccgacctttgtgtctcc
atgaacaaatcgattccagtgacccaggaactaatatgtaaagctgtgctgaatcccacc
aacgctgacatcctgattgagaccaagttggttctttctcgttttgaatttgaaggtgtt
tcttccactggagagaacgctctggaggcaggcgaagatgaggaagaggtgtggctgttt
tggagggacagcaacaaagagattcgcagcaagagtgtgagggagttggcgcaagacgct
aaagaagggcagaaggaggaccgagacgttctcagctactacagatatcagctgaacctc
tttgcgaggatgtgtctggaccgccaatacctggccatcaacgaaatctcaggccagctg
gatgtcgatctcattctccgctgcatgtctgacgagaacctgccctatgacctcagggcg
tccttctgtcgcctcatgcttcacatgcatgtggaccgagatccccaggaacaagtcacc
cccgtgaaatatgcccgcctctggtcggagattccctcggagatcgccattgacgactat
gatagtagtggagcttccaaagatgaaattaaggagagatttgcccagaccatggagttt
gtggaggagtatttaagagatgtggtttgtcagaggttccctttctctgataaggagaag
aataagcttacgtttgaggttgtaaatttagctaggaatctcatatactttggtttctac
aacttctctgaccttctacgattaactaagatccttctggccatattggactgtgtgcat
gtgacgacaatcttccccattagcaagatggcgaaaggagaagagaataaaggtaacaat
gatgtggagaagctgaagagcagtaacgtgatgagatctattcatggcgtgggagagctg
atgacccaggtggtgctccggggaggaggctttttgcccatgactcccatggctgctgcc
cctgaaggcaatgtgaagcaggcagagcctgagaaggaggacatcatggtcatggacacc
aagctgaagatcattgagatactccagtttattttgaatgtgaggttggattataggatc
tcctgcctcctgtgtatatttaagcgagagtttgatgaaagcaattcccagacttcagaa
acatcctccggaaacagcagccaagaagggccaagtaatgtaccaggtgctcttgacttt
gaacacattgaagaacaagcagaaggcatctttggaggaagtgaggagaataccccactg
gacttggatgatcacggcggcagaacctttctccgtgtcttgctccacttgacgatgcat
gactacccacccctggtgtcaggggccctgcagctcctcttccggcacttcagccagagg
caggaggtgctccaggccttcaaacaggttcaactgctggttaccagccaagatgtggac
aactacaaacagatcaagcaagacttggatcaactgaggtccatcgtggaaaagtcagag
ctttgggtgtacaaagggcagggccccgatgagaccatggatggtgcatctggagaaaat
gaacataagaaaacggaggagggaaataacaagccacaaaagcatgaaagcaccagcagc
tacaactacagagtggtcaaagagattttgattcggcttagcaaactctgtgttcaagag
agtgcctcagtgagaaagagcaggaagcagcaacagcgtctgctccggaacatgggcgca
catgctgtggtgctggagctgctgcagattccctatgagaaggccgaagataccaagatg
caagagataatgaggttggctcatgaatttttgcagaatttctgcgcaggcaaccagcag
aatcaagctttgctacataaacacataaacctgtttctcaacccagggatcctggaggca
gtaaccatgcagcacatcttcatgaacaatttccagctttgcagtgagatcaacgagaga
gttgttcagcacttcgttcactgcatagagactcacggtcggaacgtccagtatataaag
ttcttacagacaattgtcaaggcagaagggaaatttattaaaaaatgccaagacatggtt
atggccgagctggtcaattcaggagaggatgtcctcgtgttctacaacgacagagcctct
ttccagactctgatccagatgatgcggtcagagcgggatcggatggatgagaacagccct
ctcatgtaccacatccacttggtcgagctcctggctgtgtgcacggagggtaagaacgtc
tacacagagatcaagtgcaactccctgctcccgctggatgacatcgttcgcgtggtgacc
cacgaggactgcatccctgaggttaaaattgcatacattaacttcctgaatcactgctat
gtggatacagaggtggaaatgaaggagatttacaccagcaatcacatgtggaaattgttt
gagaatttccttgtcgacatctgcagggcctgtaacaacactagtgacaggaaacatgca
gactcgattttggagaagtatgtcaccgaaatcgtcatgagtattgttactactttcttc
agctctcccttctcagaccagagtacgactttgcagactcgccaacctgtctttgtgcaa
ctgctgcaaggcgtgttcagggtttaccactgcaactggttaatgccaagccaaaaagcc
tccgtggagagctgtattcgggtgctgtctgatgtagccaagagccgggccattgccatt
cccgtggacctggacagccaagtcaacaacctctttctcaagtcccacaacattgtgcag
aaaacagccatgaactggcggctctcagcccgcaatgccgcacgcagggactctgttctg
gcagcttccagagactaccggaatatcattgagagattgcaggacatcgtctccgcgctg
gaggaccgtctcaggcccctggtgcaggcagagttatctgtgctcgtggatgttctccac
agacccgagctgcttttcccagagaacacagatgccagaaggaaatgtgaaagtggcggt
ttcatttgcaagttaataaagcatacaaaacagctgctagaagaaaatgaagagaagctc
tgcattaaggtcctacagaccctgagggaaatgatgaccaaagatagaggctatggagaa
aagggtgaggcgctcaggcaaattctggtcaaccgttactatggaaacatcagaccttcg
ggaagaagagagagccttaccagctttggcaatggcccactgtcaccaggaggacccagc
aagcccgggggaggagggggaggttccggatccagctctatgagcaggggtgagatgagt
ctggccgaggttcagtgtcaccttgacaaggagggggcttccaatctagttatcgacctc
atcatgaacgcatccagtgaccgagtgttccatgaaagcattctcctggccattgccctt
ctggaaggaggcaacaccaccatccagcactcctttttctgccgcttgacagaagataag
aagtcagagaagttctttaaggtgttttatgaccggatgaaggtggcccagcaagaaatc
aaagcaacagtgacagtgaacaccagtgacttgggaaataaaaagaaagacgacgaggta
gacagggatgccccatcacggaaaaaagctaaagagcccacaacacagataacagaagag
gtccgggatcagctcctggaggcctctgctgccaccaggaaagccttcaccactttcagg
agggaggccgatcccgacgaccactaccagcctggagagggcacccaggccactgccgac
aaaaccaaggacgacctggagatgagcgcggtcatcaccatcatgcagcccatcctccgc
ttcctgcagctcctgtgtgaaaaccacaaccgagacctacagaacttcctccgttgccaa
aataacaagaccaactacaatttggtatgtgagaccctgcagtttctggactgtatttgt
ggaagcacgactggaggccttggtcttctgggcttgtatataaatgaaaagaacgtagcg
cttatcaaccaaaccctggaaagtctgaccgaatactgtcaaggaccttgccatgagaac
cagaactgcatagccacccatgaatccaatggcattgacatcatcacagccctgatcctc
aatgatatcaatcctttgggaaagaagaggatggaccttgtgttagaactgaagaacaat
gcctcaaagttgctcctggccatcatggaaagcaggcacgacagtgaaaacgcagagagg
atactttataacatgaggcccaaggaactggtggaagtgatcaagaaagcctacatgcaa
ggtgaagtggaatttgaggatggagaaaacggtgaggatggggcggcgtcccccaggaac
gtggggcacaacatctacatattagctcatcagttggctcggcataacaaagaacttcag
agcatgctgaaacctggtggccaagtggacggagatgaagctctggagttttatgccaag
cacacggcgcagatagagattgtcagattagaccgaacaatggaacagatagtctttccc
gtgcccagcatatgtgaattcctaaccaaggagtcaaaactacgaatttactatactaca
gagagagacgaacaaggcagcaaaatcaacgatttctttctgcggtctgaagacctcttc
aatgaaatgaattggcagaagaaactgagagcccagcccgtgttgtactggtgtgcccgc
aacatgtctttctggagcagcatttcgtttaacctggccgtcctgatgaacctgcttgtg
gcgtttttctacccatttaagggagtccgaggaggaaccctggagccccactggtcggga
ctcctgtggacagccatgctcatctctctggccatcgtcattgccctccccaagccccat
ggcatccgggccttaattgcctccacaattctacgattgatattttcagtcgggttacaa
cccacgttgtttcttctgggcgctttcaatgtatgcaataaaatcatctttctaatgagc
tttgtgggcaactgtgggacattcacaagaggctaccgagccatggttctggatgttgag
ttcctgtatcatttgttatatctggtgatctgtgccatggggctctttgtccatgaattc
ttctacagtctgctgctttttgatttagtgtacagagaagagactttgcttaatgtcatt
aaaagtgtcactcgcaatggacggtccatcatcctgacagcagttctggctctgatcctc
gtttacctgttctcaatagtgggctatcttttcttcaaggatgactttatcttggaagta
gataggctgcccaatgaaacagctgttccagaaaccggcgagagtttggcaagcgagttc
ctgttctctgatgtgtgtagggtggagagtggggagaactgctcctctcctgcacccaga
gaagagctggtccctgcagaagaaacggaacaggataaagagcacacatgtgagacgctg
ctgatgtgcattgtcactgtactgagtcacgggctgcggagcgggggtggagtaggagat
gtgctcaggaagccgtccaaagaggaacccctgtttgctgctagagtgatttatgacctc
ttgttcttcttcatggtcatcatcattgttcttaacctgatttttggggttatcattgac
acttttgctgacctgaggagtgagaagcagaagaaggaagagatcttgaagaccacgtgc
tttatctgtggcttggaaagagacaagtttgacaacaagactgtcacctttgaagagcac
atcaaggaagaacacaacatgtggcactatctgtgcttcatcgtcctggtgaaagtaaag
gactccaccgaatatactgggcctgagagttacgtggcagaaatgatcaaggaaagaaac
cttgactggttccccaggatgagagccatgtcattggtcagcagtgattctgaaggagaa
cagaatgagctgagaaacctgcaggagaagctggagtccaccatgaaacttgtcacgaac
ctttctggccagctgtcagaattaaaggatcagatgacagaacaaaggaagcagaaacaa
agaattggtcttctaggacatcctcctcacatgaatgtcaacccacaacaaccagcataa

DBGET integrated database retrieval system