KEGG   Pongo abelii (Sumatran orangutan): 100434204
Entry
100434204         CDS       T01416                                 

Gene name
LAMB3
Definition
(RefSeq) laminin subunit beta-3
  KO
K06244  laminin, beta 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100434204 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100434204 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100434204 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100434204 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100434204 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100434204 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100434204 (LAMB3)
   05145 Toxoplasmosis
    100434204 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II F5_F8_type_C BNR_6
Other DBs
NCBI-GeneID: 100434204
NCBI-ProteinID: XP_024090484
Ensembl: ENSPPYG00000000258
LinkDB
Position
1
AA seq 1172 aa
MRPFFLLCFALPGLLHAQQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQYG
EWQMKCCKCDSRQPHNYYSHRVENVVSSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVM
MEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRP
NARLNGGKVQLNLMDLASGIPATQSQKIQELGEITNLRVNFTRLAPVPQRGYHPPSAYYA
VSQLRLQGSCFCHGHADRCAPKPGASAGPSTAVQVHDVCVCQHNTAGPNCERCAPFYNNR
PWRPAEGQDAHECQRCDCNGHSETCHFDPAVFAASQGAYGGVCDNCRDHTKGKNCERCQL
HYFRNRRPGASIQETCIPCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCNILGSRRDMPCDEESGRCLCLPNVVGPKCDQCAPYHWKLASGQGCEP
CACDPHNSLSPQCNEFTGQCPCREGFGGLTCSAAAIRQCPDRTYGDAATGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQALRLG
SLRNATSSLWSGPGLEDRGLASRILDAKSKIEQIRAVLSSATVTEQEVAQVASAILSLRR
TLQGLQPDLPLEEETLSLLRDLESLDRSFNGLLTMYQRKREQFEKISSADPSGAFRMLTT
AYEQSAQAAQQASDSSLLLDQLRDSRREAERLVQQAGGGGGTGSPKLVALRLEMSSLPDL
TPTFNKLCGNSRQLACTPVSCPGELCPQDNGTACGSHCRGVLPRAGGAFLMAGQVAEQLR
GFNAQLQQTRQMIRAAEESASQIQSNAQHLETQVSASRSQMEEDVRRMRLLIQQVRDFLT
DPDTDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDIARAR
RLQAEAEEARSRAHAVEGQVEDVVGNLRQGTVALQEAQDTMQGTSRSLRLIQDRVAEVQQ
VLRPAEKLVTSMIKQLGDFWTRMEELRRQARQQGAEAVQAQQLAEGASEQALSAQEGFER
IKQKYAELKDRLGQSAMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAI
MLRSADLTGLEKRVEQIRDHINGRVLYYATCK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgagaccattcttcctcttgtgttttgccttgcctggcctcctgcatgcccagcaagcc
tgctcccgtggggcctgctatccacctgttggggacctgcttgttgggaggacccggttt
ctccgagcttcatctacctgtggactgacaaagcctgagacctattgcacccagtatggc
gagtggcagatgaaatgctgcaagtgtgactccaggcagcctcacaactactacagtcac
cgagtagagaatgtggtttcatcctccggccccatgcgctggtggcagtcacagaatgat
gtgaaccctgtatctctgcagctggacctggacaggagattccagcttcaggaagtcatg
atggagttccaggggcccatgcctgccggcatgctgattgagcgctcctcagacttcggt
aagacctggcgagtgtaccagtacctggctgccgactgcacctccaccttccctcgggtc
cgccagggtcggcctcagagctggcaggatgttcggtgccagtccctgccccagaggcct
aatgcacgcctaaatggggggaaggtccaacttaaccttatggatttagcatccgggatt
ccagcaactcaaagtcaaaaaattcaagagctgggggagatcacaaacttgagagtcaat
ttcaccaggctggcccctgtgccccaaaggggctaccaccctcccagtgcctactatgcc
gtgtcccagctccgtttgcaggggagctgcttctgtcatggccatgctgatcgctgcgca
cccaagcctggggcctctgcaggcccctccaccgctgtgcaggtccacgatgtctgtgtc
tgccagcacaacactgccggcccaaattgtgaacgctgtgcacccttctacaacaacagg
ccctggagacctgcagagggccaggacgcccatgaatgccaaaggtgcgactgcaatggg
cactcagagacatgtcactttgaccccgctgtgtttgccgccagccaaggggcatatgga
ggtgtgtgtgacaattgccgggaccacaccaaaggcaagaactgtgagcggtgtcagctg
cactatttccggaaccggcgcccgggagcttccattcaggagacctgcatcccctgcgag
tgtgatccagatggggcagtgccaggggctccctgtgacccagtgactgggcagtgtgtg
tgcaaggagcatgtgcagggagagcgctgcgacctatgcaagccgggctttactggactc
acctacgccaacccgcagggctgccaccgctgtgactgtaacatcctggggtcccggagg
gacatgccgtgtgacgaggagagtgggcgctgcctttgtctgcccaacgtggtgggtccc
aaatgtgaccagtgtgctccttaccactggaagctggccagcggccagggctgtgaacca
tgtgcctgcgacccgcacaactccctcagcccacagtgcaacgagttcacagggcagtgc
ccctgtcgggaaggctttggtggcctgacgtgcagcgctgcagccatccgccagtgtcca
gaccggacctacggagacgcggccacaggatgccgagcctgtgactgtgatttccgggga
acagagggcccgggctgcgacaaggcatcgggccgctgcctctgccgccctggcttgacc
gggccccgctgtgaccagtgccagcgaggctactgcaaccgctacccagtgtgcgtggcc
tgtcacccttgcttccagacctatgatgcggacctccgggagcaggccctgcgccttggt
agcctccgcaatgccacctccagtctgtggtcagggcctgggctggaggaccgtggcctg
gcatcccggatcctagatgcaaagagtaagattgagcagatccgagcagttctcagcagc
gccacagtcacagagcaggaggtggctcaggtagccagtgccatcctctccctcaggcga
actctccagggcctgcagccggatctgcccctagaggaggagacgttgtcccttctgaga
gacctggagagtctggacagaagcttcaatggtctcctcactatgtatcagaggaagagg
gagcagtttgaaaaaataagcagtgctgatccttcaggagccttccggatgctgaccaca
gcctacgagcagtcagcccaggcggctcagcaggcctccgacagctcgctccttttggac
cagctcagggacagccggagagaggcagagaggctggtgcagcaggcgggaggaggagga
ggcaccggcagccccaagcttgtggccctgaggctggagatgtcttcgttgcctgacctg
acacccaccttcaacaagctctgtggcaactccaggcagttggcttgtaccccagtatca
tgccctggtgagctgtgtccccaagacaatggcacagcttgtggctcccactgcaggggt
gtccttcccagggccggtggggccttcttgatggcagggcaggtggctgagcagctgcgg
ggtttcaatgcccagctccagcagaccaggcagatgattagggcagccgaggaatctgcc
tcacagattcaatccaatgcccagcacttggagacccaggtgagcgccagccgctcccag
atggaggaagatgtcagacgcatgcggctgctaatccagcaggtccgagatttcctgaca
gaccccgacactgatgcagccactatccaggaggtcagcgaggccgtgctggccctgtgg
ctgcccacagactcagctactgttctgcagaagatgaatgagatccaggccattgcagcc
aggctccccaacgtggacttggtgctgtcccagaccaagcaggacattgcgcgtgcccgc
cggttgcaggctgaggctgaggaagccaggagccgagcccatgcagtggagggccaggtg
gaggatgtggttgggaacctgcggcaggggacagtggcactgcaggaagctcaggacacc
atgcaaggcaccagccgctcccttcggcttatccaggacagggttgctgaggttcagcag
gtactgcggccagcagaaaagctggtgacaagcatgatcaagcagctgggtgacttctgg
acacggatggaggagctccgccgccaagcccggcagcagggggcagaagcagtccaggcc
cagcagcttgcggaaggtgccagcgagcaggcattgagtgcccaagagggatttgagaga
ataaaacaaaagtatgctgagttgaaggaccggttgggtcagagtgctatgctgggtgag
cagggcgcccggatccagagtgtgaagacagaggcagaggagctgtttggggagaccatg
gagatgatggacaggatgaaagacatggagttggagctgctgcggggcagccaggccatc
atgctgcgctcggcggacctgacaggactggagaagcgtgtggagcagatccgtgaccac
atcaatgggcgcgtgctctactatgccacctgcaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100438698
Entry
100438698         CDS       T01416                                 

Gene name
LAMA1
Definition
(RefSeq) laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100438698 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100438698 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100438698 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100438698 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100438698 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100438698 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100438698 (LAMA1)
   05414 Dilated cardiomyopathy
    100438698 (LAMA1)
   05416 Viral myocarditis
    100438698 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100438698 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100438698 (LAMA1)
   05145 Toxoplasmosis
    100438698 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_B Laminin_N Laminin_II Laminin_G_3 DUF1080 Hepar_II_III
Other DBs
NCBI-GeneID: 100438698
NCBI-ProteinID: XP_024091886
LinkDB
Position
18
AA seq 3079 aa
MRWAGAWVLGLALLLCSVARCQQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHV
PGRPVRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQV
FQVAYVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRA
DDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNA
DLMTLSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNT
CGESCNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFR
GGGVCINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHS
DLHNGKWPGQCPCKEGYAGEKCDRCQLGYKDYPTCVSCGCNPAGSASDEPCTGPCVCKEN
VEGKACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNDMSGWLVTDLISP
RKILSQQDALGRRHQVSINNTAVMQRLALKYYWAAPKAYLGNKLTAFGGFLKYTVSYEIP
VETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYTNVVRLVPENFRDFHSKMQIDR
DQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASPNAIDLVVAADVEHCECPQGYT
GTSCELCLSGYYRVDGILFGGICQACECHGHAAECDVHGVCIACAHTTTGDHCEQCLPGF
YGEPSRGTPGDCQPCACPLTIASNNFSPTCHLSDGDEVVCDRCAPGYSGAWCERCADGYY
GNPTVPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTA
KNCRACECHVKGSHSAVCHPETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCQPCNCSVA
GSVSDDCTDEGQCHCVPGVAGKRCDRCARGFYTYQDGSCTPCDCPHTQNTCDPETGECVC
PPHTQGVKCEECEDGHWGYDVEVGCQACNCSLVGSTHHQCDVVTSHCQCKSKFGGRACDQ
CSLGYRDFPDCVPCDCDLRGTSGDACNLEQGLCGCAEETGACPCKENVFGPQCNECREGT
FALRADNPLGCSPCFCSGLSHLCSELEGYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYY
QAPDFLLDAATIRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGIGTSNFEP
QVLIKGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSD
IEYILIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDC
APGYHRGKLPAGSDRGLRPLIAPCVPCSCNNHSDTCDPDTGKCLNCGDNTAGDHCDVCAS
GYYGKVTGSASDCAPCACPHSPPASFSPTCVLEGDHNFRCDACLLGYEGKHCERCSSGYY
GNPQTPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSC
DDECVGVLLNDLDEIGDAILSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGK
IKLEGVAEEMDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTT
LNQTLDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENY
QKPLEELEVLKEAASHLLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKK
LHVQEEQNLTSELIAQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLV
MHMSQRNALDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEES
EELARDAHRTVTETSLLSESLVYNGKAAVQRSSKFLKEGNNLSRRLPGIALELSELRNKT
NRFQENAVEITWQTNESLLILRAIPEGIRDKGAKTKELATSASQSAVSTLRDVAGLSQEL
LNTSASLSRVNTTLQETHQLLQDSTMATLLAGRKVKDVETQANLLFDRLKPLKMLEENLS
RNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLF
YLGSSTASDFLAVEMRRGKVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLS
VKEMSSNQKSPTKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAF
LNGKSIGLWNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTF
SPNGLLLYLGSYGTKDFLSIELFHGRVKVMTDLGSGPLTLLTDRRYNNGTWYKIAFQRNR
KQGVLAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVG
CLKNLEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLLPESEWLVTFAT
TNSSGIILAALGGDVEKRGDREEAHVPFFSIMLIGGNIEVHVNPGDGTGLRKALLHAPTG
TCSDGQAHSISLVRNRRIITVQLDENNPVEMKLGPLVESRTINVSDLYVGGIPEGEGTSL
LTMRRSFHGCIKNLIFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRA
FPEQCVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMA
HQNQADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGFITVDGQ
ESPMVTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVMVNSKQLDKDSP
VSAFTVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAK
VDAIGLELVDGKVLFHVNNGAGRITAAYEPKTTTALCDGKWHTLQAKKSKHRITLIVDGN
AVGAESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQVQSFDF
SRAFELHGVFLHSCPGTES
NT seq 9240 nt   +upstreamnt  +downstreamnt
atgcgctgggccggcgcgtgggtcctgggcctggccttgctgctgtgtagcgtcgcgcgg
tgccagcagagaggcctgtttcctgccattctcaatcttgccagcaatgctcacatcagc
accaatgccacctgtggcgagaaggggcccgagatgttctgcaaacttgtggagcatgtg
ccaggtcggcccgtccgaaacccacagtgccggatctgtgatggcaacagcgcaaacccc
agagagcgccatccaatatcacatgccatagatggcaccaataactggtggcaaagtccc
agcattcagaatgggagagagtatcactgggtcacaatcactctggacttaagacaggtc
tttcaagttgcatatgtcatcattaaagctgccaatgcccctcgacctggaaactggatt
ttggagcgttctctggacggcaccacattcagcccttggcagtattatgcagtcagcgac
tcagagtgtttgtctcgttacaatataactccaagacgagggccacccacctacagggct
gatgatgaagtgatctgcacctcctattattccagattggtgccacttgagcatggagag
attcatacatcactcatcaatggcagaccaagcgctgacgatctttcacccaagttgttg
gaattcacttctgcacgatatattcgccttcgcttacaacgcattagaacgctgaatgca
gatctcatgacccttagccaccgggaacctaaagaactggatcctattgttaccagacgc
tattattattcaataaaggacatttctgttggaggcatgtgtatctgctatggccatgct
agtagctgcccgtgggatgaaactacaaagaaactgcagtgtcaatgtgagcataatact
tgcggggagagctgtaacaggtgctgtcctgggtaccatcagcagccctggaggccggga
accgtgtcctccggcaatacctgtgaagcatgtaattgtcacaataaagccaaagactgt
tactatgatgaaagtgttgcaaagcagaagaaaagtttgaatactgctggacagttcaga
ggaggaggggtttgcataaattgcttgcagaacaccatgggaatcaactgtgaaacctgt
attgatggatattatagaccacacaaagtgtctccttatgaggatgagccttgccgcccc
tgtaactgtgaccctgtggggtccctcagttctgtctgtattaaggatgacctccattct
gacttacacaatgggaagtggccgggtcagtgcccatgtaaggaaggctatgcaggagaa
aaatgtgatcgctgccaacttggctataaggattacccgacctgtgtctcctgtgggtgc
aacccagcgggtagtgccagtgatgagccctgcacagggccctgtgtttgtaaggaaaac
gttgaggggaaggcctgtgatcgctgcaagccaggattctataacttgaaggaaaaaaac
ccccggggctgctccgagtgcttctgctttggcgtttctgatgtctgcagcagcctctct
tggcctgttggtcaggtaaacgatatgtccgggtggctggtcaccgacttgatcagtccc
aggaagatcctgtctcagcaagatgcactaggcaggcgccatcaggtcagcatcaacaac
accgcggtcatgcagaggctggctctcaagtactactgggcggcccccaaggcctacctt
ggaaataagctgactgcgtttggtggattcctgaaatacacggtgtcttacgaaattcca
gtagagacggtagacagtaacctcatgtcgcatgctgacgtcatcattaagggaaacgga
ctcactttaagcacacaggctgagggtctgtcattgcagccttatgaagagtacacaaat
gtggttagacttgtgcctgaaaacttccgagattttcacagcaaaatgcagattgatcgt
gaccagctgatgactgtccttgccaatgtgacacatcttttgatcagagccaactacaat
tctgcaaaaatggctctttacaggttggagtccgtctctctggacatagccagccctaat
gccatcgacctggtggtggccgctgatgtggagcactgtgaatgtccacaaggctacaca
gggacctcctgtgagttgtgcctctctggctattaccgcgtggatggaatactctttgga
ggaatttgtcaagcctgcgaatgccacggccatgcagctgagtgcgacgttcatggcgtt
tgcattgcatgtgcgcacaccaccaccggcgaccactgtgaacagtgcttgcccggcttc
tacggggagccttcccgagggacacctggggactgccagccctgcgcctgccctctcacc
atagcctccaacaatttcagccccacctgccacctcagtgatggagatgaagtggtctgt
gaccggtgtgccccgggctactcaggagcttggtgtgagagatgtgcagatggttactat
ggaaacccaaccgtgcctggcgaatcttgtgttccctgtgactgcagcggcaatgtggac
ccctcggaggctggtcactgtgactcagtcaccggggagtgcctgaagtgcctggggaac
acagacggcgcccactgtgaaaggtgtgctgacgggttctacggggatgctgtgacagcc
aagaactgccgcgcctgtgaatgccatgtgaaaggctcccattctgccgtgtgccatcct
gagaccgggctctgcgactgcaaaccaaacgtgactggacagcagtgtgaccagtgcttg
catggctattatgggctggactcaggccatggctgccagccctgcaactgcagtgtggca
ggctccgtgtcagatgactgcacggatgaaggccagtgtcactgcgtcccaggtgtggca
gggaaaaggtgtgacaggtgtgcccgtggcttctacacctatcaggatggtagctgtaca
ccctgtgactgcccacacactcagaatacctgcgacccagaaactggagagtgtgtctgc
ccccctcacacacagggtgtgaagtgtgaagaatgtgaggatgggcactggggctacgat
gtggaggtggggtgccaggcctgcaattgcagtctcgtggggtcgactcatcatcagtgc
gatgtggtcaccagccattgccagtgcaagtcaaaatttggtggccgggcctgcgatcag
tgttccttgggttacagagattttcctgactgtgttccctgtgactgtgacctgaggggg
acgtcgggggacgcctgcaacctggagcagggtctctgcggctgtgcggaggaaaccggg
gcctgcccttgtaaggagaatgtctttggccctcagtgcaacgagtgtcgagagggcacc
tttgctctccgcgcagacaaccccctgggctgcagcccctgcttctgctccgggctgtcc
cacctctgctcagagctggagggctacgtgaggaccccagtaacgctgggctccgatcag
cctcttctgcgtgtggtttctcagagtaacttgaggggcacgaccgagggggtttactac
caggcccccgacttcctgctggatgccgccaccatccggcagcacatccgtgcagagccg
ttttactggcggctgccgcagcagttccaaggagaccagctcatggcctatggtggcaaa
ctgaagtacagcgtggccttctattctttggatggcatcggcacctccaattttgagcct
caagttctcatcaaaggtggtcggatcagaaagcaagtcatttacatggatgcaccagcc
cctgagaatggagtgagacaggaacaagaagtagcaatgagagagaatttttggaaatat
tttaactctgtttctgaaaaacctgtcacgcgagaggattttatgtctgtccttagcgat
attgagtacatcctcatcaaggcatcgtatggtcaaggattacagcagagcagaatctca
gacatttcaatggaggttggcagaaaggctgaaaagctgcacccagaagaagaggttgca
tctcttttagagaattgtgtctgtcctcctggcactgtgggattctcatgtcaggactgt
gcccctgggtaccacagagggaagctcccagcagggagtgacaggggactgcgccctctg
attgctccttgtgtaccctgcagttgcaacaaccatagtgacacctgtgaccctgacacc
gggaagtgtctgaactgtggcgataacacagcaggtgaccattgtgatgtgtgtgcttct
ggttactacgggaaggtgactggctcagcaagtgactgtgctccgtgtgcctgtcctcac
agccctcctgccagttttagtcccacttgcgtcttggaaggtgaccacaatttccgttgt
gacgcctgtctcctgggctatgaaggaaaacattgtgaaaggtgctcctctggctattat
gggaaccctcaaacaccaggtggcagttgccagaagtgtgactgcaacccgcacggctct
gtccacggtgactgtgaccgcacatctgggcagtgcgtttgtaggctgggggcctcgggg
ctccggtgcgatgagtgtgaaccgaggcacattctgatggaaacggattgtgtttcctgt
gatgatgagtgtgtaggtgtgctgctgaatgacttggatgagattggtgatgccattctt
tctctgaacctcactggcattatccctgtcccatatggaattttgtcaaacctggaaaat
acaacgaaatatctccaggaatcattattaaaagaaaatatgcaaaaggacctggggaaa
attaagcttgaaggtgttgcagaagaaatggacaacctgcaaaagaagctcactagaatg
ttagcgagtacccaaaaggtgaatagggcaactgagagaatcttcaaggagagtcaagat
ctggccatagccattgagaggctgcagatgagcatcacagaaattatggaaaagacaact
ttaaatcagactttggacgaagatttcctactacccaattctactcttcagaacatgcaa
cagaatggtacatctttgctagaaatcatgcagataagagacttcacacagttgcaccaa
aatgccacccttgaactcaaggctgctgaagatttattgtcacaaattcaggaaaattac
cagaagccgctggaagaattggaggtattgaaagaagcagcaagccacctcctttcaaag
cacaataatgaactaaaggcggctgaggcgctcgtgagggaagctgaggcaaagatgcag
gaaagcaaccacctgctgctcatggtcaatgctaatctgagagaattcagtgataaaaag
ctacatgttcaagaagaacaaaatctgacctcagaactcattgcccaaggaagaggattg
atagatgctgctgctgcacaaacagatgctgtacaagatgctctagagcacttagaggat
caccaggataagctacttttatggtctgccaaaatcaggcaccacatagatgacctggtc
atgcacatgtcccaaaggaacgcactcgacctggtctacagagctgaggaccatgccgct
gagttccagagactagcagatgttctgtacagtggccttgaaaacatcagaaatgtgtcc
ctgaatgccaccagtgcagcctatgtccattacaacatccagagcctgatcgaagaatcg
gaggaactggccagagatgctcacaggactgtgactgagacgagcctgctctcagaatcc
cttgtttataatgggaaagcggccgtgcagcgcagctccaaatttctaaaagaaggcaac
aacctcagcaggaggcttccaggtattgcattggaactgagtgaattgagaaataagaca
aacagatttcaagagaatgctgttgaaattacctggcagaccaatgaatcactcttgata
cttagagcaattcctgaaggtataagagacaagggagccaaaaccaaagagctggccacg
tctgcaagccagagcgcggtgagcacgctgagggacgtggcggggctgagccaggagctg
ctgaacacatctgccagcctgtctagggtcaacaccacattacaagagacgcaccagctt
ctgcaggactccaccatggccactctgttggctggaagaaaagtcaaagatgtggaaact
caagccaaccttttgtttgatcggttgaagcccttgaagatgttagaggagaatctgagc
agaaacctatcagaaattaaactgttgatcagccaggcccgcaaacaagcagcttctatt
aaagtcgctgtgtctgcagacagagattgcatccgggcctaccagcctcagatttcctct
accaactacaacaccttaacactaaatgttaagacacaggaacccgataatcttctcttc
tacctcggtagcagcaccgcttctgatttccttgcagtggagatgcggcgagggaaagtg
gccttcctgtgggacctgggctctgggtccacacgcttggagtttccagactttcccatt
gatgacaacagatggcacagtatccatgtagccagatttggaaacattggttcactgagt
gtaaaggaaatgagctcaaatcagaagtcaccaacaaaaacaagtaaatcccctgggaca
gctaatgttctggatgtaaataattcaacactcatgtttgttggaggtcttggaggacaa
atcaagaaatctcctgctgtgaaggttactcattttaaaggctgcttgggagaggccttc
ctgaatggaaaatccatcggcctatggaactatattgaaagggaaggcaagtgccgtggg
tgctttggaagctcccagaatgaagacccttccttccattttgacgggagtgggtactct
gtcgtggagaagtcacttccggctaccgtgacccagataatcatgctttttaataccttt
tcacctaacggacttcttctctacctgggttcatacggcacaaaagactttttatccatc
gagctgtttcacggcagagtgaaggttatgactgacctgggttcaggaccccttaccctt
ttgacagacagacgttataacaatggaacctggtacaaaattgccttccagcgaaaccgg
aagcaaggagtcctagcagttatcgatgcctataacaccagtaataaagaaaccaagcag
ggtgagactccgggagcatcttctgacctcaaccgcctagacaaggacccgatttatgtg
ggtggattaccaaggtcaagagttgtaaggagaggtgtcaccaccaaaagctttgtgggc
tgcctcaagaacctggaaatatccagatcaacctttgacttactcagaaattcctatgga
gtgagaaaaggctgtttactggagcccatccggagtgttagcttcttgaaaggcggctac
attgaattgccacccaaatctttgttaccagaatcggaatggctggtaacatttgccacc
acgaacagcagtggcatcatcctggctgccctcggcggggatgtggagaagcggggtgat
cgtgaggaagcacatgtgcccttcttttccatcatgctgatcggaggcaacattgaggta
catgtcaatcctggggatgggacaggcctgagaaaagctctcctgcacgctcccacgggt
acatgcagcgatggacaagcgcattccatctccttggtcaggaatcggagaattatcact
gtccaattggatgagaacaatcctgtggaaatgaagttgggcccattagtagaaagcagg
acgataaatgtgtccgatctgtacgtcgggggaattccagagggagaggggacatcgctg
ctcacaatgagaagatcgttccatggctgtatcaaaaacctgatcttcaatttggaactt
ttggatttcaacagtgcagttggccatgagcaagtcgacttggacacctgctggctgtca
gaaaggcctaagctggctcccgatgcagaggacagcaagctcttgccagagccccgggct
tttccagaacagtgtgtggtggatgcagctctggagtacgttcctggcgctcaccagttt
ggtctcacacaaaacagccatttcatcttgccttttaatcagtcggctgtcagaaagaag
ctctcggttgagctaagtatccgcacgttcgcctccagcggcctgatttactacatggct
catcagaaccaagcagactacgccgtgctccagctgcacgggggccgcctccacttcatg
tttgaccttggcaaaggcagaacaaaggtctctcaccctgcactgctcagcgatggcaag
tggcacacggtcaagacagactatgttaaaagaaaaggcttcataactgttgacggccaa
gagtcccccatggtgactgtggtgggagacggaaccatgctggatgtggagggtttgttc
taccttggaggcctgccctcccagtaccaggccaggaaaattggaaatatcacccacagc
atccctgcctgcattggggatgtgatggttaacagcaaacagctggacaaggacagcccg
gtgtctgccttcacggtgaacaggtgctacgcagtggcccaggaaggaacatactttgac
ggaagcggatatgccgctcttgtcaaagagggctacaaagtccagtcagatgtgaacatc
acactggagtttcgaacctcctcgcagaatggcgtcctcctggggatcagcactgccaaa
gtggatgccattggactagagcttgtggacggcaaggtcttgttccatgtcaacaatggt
gctggcaggataacagctgcatatgagcccaaaaccaccactgcgctctgtgatggaaaa
tggcacactcttcaggctaagaaaagcaaacaccgtatcactctgattgtcgacgggaac
gcagttggcgctgaaagtccacacacccagtctacctcggtggacaccaacaatcccatt
tatgttggtggctatcctgctggtgtgaagcaaaaatgcctgcgcagccagacctcgttc
cgcgggtgtttgaggaagctagctctgattaagagcccacaggtgcaatcctttgacttc
agcagagcgttcgaactgcatggagttttccttcattcctgtcctgggaccgagtcctga

KEGG   Pongo abelii (Sumatran orangutan): 100439539
Entry
100439539         CDS       T01416                                 

Gene name
LAMA3
Definition
(RefSeq) laminin subunit alpha-3
  KO
K06240  laminin, alpha 3/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100439539 (LAMA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100439539 (LAMA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100439539 (LAMA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439539 (LAMA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100439539 (LAMA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100439539 (LAMA3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100439539 (LAMA3)
   05145 Toxoplasmosis
    100439539 (LAMA3)
SSDB
Motif
Pfam: Laminin_I Laminin_EGF Laminin_G_2 Laminin_N Laminin_G_1 Laminin_II Laminin_B Laminin_G_3 Spc7 EzrA
Other DBs
NCBI-GeneID: 100439539
NCBI-ProteinID: XP_024091751
LinkDB
Position
18
AA seq 3289 aa
MAAAARPRGRAPGPVLPPTPLLLLVLRVLPAWGATARDSGAAAGLSLHPPYFNLAEAARI
WATATCGERGPGEGRPQPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAI
DGSERWWQSPPLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGST
YSPWQYFAHSKVDCLKEFGREANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLINGRPGA
KNFTFSQTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGQCV
CNGHAEVCNVNNPEKLFRCECQHHTCGETCDRCCTGYNQRRWRPAAWEQSHECEACNCHG
HASDCYYDPDVERQQASLTTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAP
DGCIPCSCDPEHADGCEQGSGRCHCKPNFHGDNCEKCAVGYYSFPFCLRIPIFPVSMPSP
EDPVAGDIKGNWCDCNLEGVLPEICDAHGRCLCHPGVEGPRCDTCRSGFYSFPICQGSSS
ACDPAGTINSNLGYCQCKLHVEGPTCSSCKQLYWNLDKENPNGCSECQCHKAGTVSGTGE
CRQGDGDCHCKSHVGGDSCDTCEDGYFALEKRNYFGCQGCQCDIGGASSSVCSGPSGVCQ
CREHVVGKACQQPENNYYFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPEFSWRGYAQM
TSVQNDVRITLNVGKSSGSLFRVILRYVNPGTEAVSGHITIYPSWGAAQSKEIIFLPSKE
PAFVTVPGNGFADPFSITPGIWVACIKAEGVLLDYLVLLPKDYYEASVLQLPVTEPCAYA
GPPQENCLLYQHLPVTRFPCTLACEARHFLLDGEPRPLAVRQLTPAHPVMVDLSGREVEL
HLRLRVPQVGHYVVVVEYSTKAAQLFVVDVNVKSPGSVLAGQVNIYSCNYSVLCRSAVID
HMSRIAMYELLADADIQLKGHMARFLLHQVCIIPIEEFSAEYVRPQVHCIASYGQFVNQS
ATCVSLAHETPPTALILDGLSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRVPHL
GRYVFVIHFYQAAHPTFPAQVSVDGGWPRAGSFRASFCPHVLGCRDQVITEGQIEFDISE
PEVAATVKVPEGKSLVLVRVLVVPAENYDYQILHKKSMDKSLEFITNCGKNSFYLDPQTA
SRFCKNSARSLVAFYHKGALPCECHPTGATGPHCSPEGGQCPCWPNVIGRQCTRCATGHY
GFPRCKPCSCGRRLCEEMTGQCHCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTI
EAAMPECDRDSGQCRCKPRITGRQCDQCASGFYRFPECVPCNCNRDGTEPGVCDPGTGAC
LCKENVEGTECNVCREGSFHLDPANLKGCTSCFCFGVNNQCHSSHKRRTKFVDMLGWRLE
TADRVDIPVSFNPGSNSMVADLQELPATVSSASWVAPTSYLGDKVSSYGGYLTYQAKSFG
LPGDMVLLEKKPDVQLTGQHMSIIYEETNTPRPDRLHHGRVQVVEGNFRHASSRAPVSRE
ELMTVLSRLADVRIQGLHFTETQRLTLSEVGLEEASDTGSGHIALAVEICACPPAYAGDS
CQGCSPGYYRDHKGLYTGRCVPCNCNGHSNRCQDGSGICVNCQHNTAGEHCERCQEGYYG
NAIHGSCRACPCPHTNSFATGCVVSGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSC
QPCSCNSNGQLGSCDPLTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVK
SQLQGLSASAGLLEQMRHLETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFET
LQEKAQVNSRKAQTLYNNVNRATQSAKELDVKIKNVIRNVHILLKQISGTDGEGNNVPSG
DFSREWAEAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSI
RDSLNEYEAKLSDLHARLQEAAARAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYL
TTADSSLLQTNIALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEK
HAQSLQELAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESAL
QTVIKEDLPRKAKTLSSSSDKLLNEAKMTQKKLKQEVSPALNNLQKTLNIVTVQKEVIDT
NLTTLRDGLRGIQRGDIDAMISSAKSMVRKANDITDEVLDGLSPIQTDVERIKDTYGSTQ
NEDFKKALTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAA
NKVAVPMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDA
SRDYIGMAVVDGQLTCVYNLGDHETELQADQILTKSETKEAVMDRVKFQRIYQFARLNYT
KGATSSKPETPGVYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIEL
DDLNENVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYAQVPTQPHAPIPTFGQ
TIQTTVDRGLLFFAENRDRFISLNIEDGKLMVRYKLNSEPPKERGVGDAINNGRDHSIQI
KIGKLQKRMWINVDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKT
SGVVRLNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSG
ILLDHQTQTSSLQVTLEDGYIELSTRDSSGPIFKSPQTYMDGLLHYVSVIRDNSGLRLLI
DDQPLRNNERLKRISSSQQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSL
GSCSLNKPPFLMLLKGSTRFNKTKTFRINQLLQDTPVASPRSMKVWQDACSPLPKTQANH
GALQFGDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGAKNSFMALYLSKGRL
VFALGTDGKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRA
PVYLGSPPSGKPKSLPTNSFVGCLKNFQLDSKPLDTPSSSFGVSSCLGGPLEKGIYFSEE
GGHVVLAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAG
GTSTSVTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGA
PANLTTLRIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDH
NT seq 9870 nt   +upstreamnt  +downstreamnt
atggcggcggccgcgcggcctcggggtcgggcaccggggccagtcctgccgccgacgccg
ctgctgctgctggtactgcgggtgctgccagcctggggggcgaccgctcgggattccggg
gctgcggccgggctcagccttcacccgccttacttcaacctggccgaggcggcgaggatt
tgggccaccgccacctgcggggagaggggacccggcgaggggaggccccagcccgagctc
tactgcaagttggtcgggggccctaccgccccaggcagcggccacaccatccagggccag
ttctgtgactattgcaattctgaggaccccaggaaagcacatcctgtcaccaatgccatc
gatggatctgaacgttggtggcaaagccctcccctgtcctcaggcacacagtacaacaga
gtcaacctcaccttggatctggggcagctcttccatgtggcctatattttaatcaaattt
gcaaattctcctcgccctgacctttgggtcttggaaagatctgtagactttggaagcacc
tactcaccatggcaatattttgctcattctaaagtagactgtttaaaagaatttgggcgg
gaggcaaatatggctgtcacccgggatgatgatgtactttgtgttactgaatattcccgt
attgtacctttggaaaatggtgaggttgtggtgtccttgataaacggtcgtccaggtgca
aaaaattttactttctctcaaaccctgagggagtttaccaaggcaacaaacatccgcttg
cgttttcttcgaaccaatacgcttcttggacacctcatctccaaagcccagcgagatcca
actgtcactcggcggtattattacagcataaaggacatcagcattggtgggcagtgtgtt
tgcaatggccatgctgaagtgtgcaatgtaaacaatcctgaaaaactgtttcggtgtgaa
tgccagcaccacacctgtggggagacgtgtgatcgctgctgcacagggtacaatcagagg
cgctggcggcccgccgcgtgggagcagagccacgagtgtgaagcatgcaactgccacggc
catgccagcgactgttactatgatccagatgttgagcggcagcaggcaagcttgactacc
cagggcatctatgctggtggaggggtgtgcattaactgtcagcacaacacagctggagta
aactgtgaacagtgtgctaagggctattaccgcccttatggggttccagtggatgcccct
gatggctgcatcccctgcagctgtgaccctgagcatgcggatggctgtgaacagggctca
ggccgctgtcactgcaagccaaatttccatggagacaactgtgagaagtgtgcagttgga
tactacagtttcccattttgcttgagaattcccatttttcctgtttctatgccaagtcca
gaagatccagtagctggagatataaaaggcaactggtgtgactgtaatctggaaggcgtt
ctccccgaaatatgtgatgcccatggacggtgcctgtgtcaccctggggttgagggccct
cgatgtgatacctgccgctctggtttctactcattccctatttgccaaggttccagcagt
gcttgtgacccagctggtaccatcaactccaatttggggtattgccagtgcaagcttcat
gttgaaggtcctacttgtagcagctgcaaacagttatattggaatctggacaaagaaaac
cccaatggatgttcagaatgccagtgccataaggcgggaacagtgagtggaactggagag
tgtaggcagggagatggtgactgtcactgcaagtcccatgtgggtggcgattcctgtgac
acctgtgaagatggatattttgctttggaaaagagaaattactttgggtgtcaagggtgt
caatgtgacattggtggggcatcgtcctctgtgtgcagcgggccctccggagtgtgccag
tgccgagagcatgtcgtgggaaaggcgtgccagcagcctgaaaacaactactatttccca
gatttgcatcatatgaagtatgagattgaagatggcagcacacctaatgggagagacctt
cgatttggatttgatccgctggcatttcctgagtttagctggagaggatatgcccaaatg
acctcagtacagaatgatgtaagaataacattgaatgtagggaagtcaagtggctccttg
tttcgtgttattctgagatacgttaaccctggaactgaagcagtatctggccatataact
atttatccatcctggggtgctgctcaaagcaaagagatcatcttcctgccgagtaaggag
ccagcctttgtcaccgtccctggaaatggttttgcagacccattttcaatcacaccagga
atatgggttgcttgtattaaggcagaaggagtccttctggattacctggtgctgctcccc
aaggactactatgaagcctctgtactgcagctgccagtcacagaaccatgtgcctacgca
ggacctccccaagaaaattgcttgctctaccagcatttgccagtgaccagattcccctgt
accctggcttgtgaggccagacacttcctgcttgatggggagccaagacccttggcagtg
aggcagctcacacctgcacaccctgtcatggtggacctcagtgggagagaggtggaattg
catctgcggctgcgcgtcccacaggttggccactacgtggttgtggtcgagtattccacg
aaggcagcccagctgtttgtggttgatgtgaatgtgaagagccccgggtctgttctggca
ggccaggtgaacatttacagctgcaactacagtgttctctgccggagcgctgtgattgat
cacatgagccgcatcgccatgtatgagctattggcagatgcagacattcagctcaaggga
cacatggcccgattccttctgcatcaagtttgtatcatacccattgaagaattctcagct
gagtatgtgagaccgcaagtccactgcattgccagttacgggcaatttgtcaatcaaagt
gccacctgtgtctccctggcccacgaaactcctccaacagcattaattttggatggtcta
agtggcaggcctttccctcacctgccccagcagtcttcaccttctgttgatgttcttcct
ggggtcaccttgaaggcaccgcagaatcaagtgaccctgagaggacgtgtaccacacctg
ggccgatacgtctttgtcatccatttttaccaagcagcacacccgacgtttcccgcgcag
gtgtcagtggacggcgggtggccacgggcaggctccttccgtgcctctttttgcccccat
gtgcttggctgccgggatcaagtgattaccgaaggccagattgagtttgacatctcagag
cctgaagtggctgcaaccgtgaaggttccagaaggaaagtccttggttttggtccgtgtt
ctagtggtgcctgcagaaaactatgactaccaaatacttcacaaaaaatccatggacaag
tcactcgagtttatcaccaattgtggaaaaaacagcttttaccttgacccccagacagcc
tccagattctgtaagaattccgccaggtccctggtggccttttaccacaagggcgccctg
ccttgtgagtgccaccccactggggccaccggccctcactgcagccctgagggtgggcag
tgcccatgctggcccaacgtcattgggcggcagtgcacccgctgtgcaacaggccactac
ggattcccacgctgcaagccgtgcagctgtggtcggcgcctttgtgaagagatgacgggg
cagtgccactgccctccgcgcacggtcaggccccagtgtgaggtgtgtgagacacactca
ttcagcttccatcccatggccggctgcgaaggctgcaattgttccaggaggggcaccatc
gaggctgccatgccggagtgtgaccgggacagtgggcagtgcagatgcaagcccagaatc
acagggcggcagtgtgaccaatgtgcttccgggttttaccgcttccctgagtgtgttccc
tgcaattgcaacagagatgggactgagccaggagtgtgtgacccagggaccggagcttgc
ctctgcaaggaaaatgtagaaggcacagagtgtaatgtgtgtcgagaaggctcattccat
ttggacccagccaatctcaagggttgtaccagctgtttctgttttggagtaaataatcaa
tgtcacagctcacataagcgaaggactaagtttgtggatatgctgggctggcgcctggag
acagcagacagagtggacatccctgtctctttcaacccgggcagcaacagcatggtggca
gatctccaggagctgcctgcaaccgtcagcagcgcgtcctgggtcgcacccacctcctac
ctgggggacaaggtttcttcgtatggtggttacctcacttaccaagccaagtccttcggc
ttgcctggtgacatggttcttctggaaaagaagccggatgtacagctcactggtcagcac
atgtccatcatctatgaggagacaaacaccccacggccagaccggctgcatcatggacga
gtgcaggtggtcgagggaaacttcagacatgccagcagccgtgccccggtgtctagggag
gagctgatgacagtgctgtctagactggcagatgtgcgcatccaaggcctccacttcaca
gagactcaaaggctcaccctgagtgaggtggggctagaggaagcctctgacacaggaagt
ggacacatagcacttgctgtggaaatctgtgcctgcccccctgcctacgctggtgactct
tgtcagggttgtagccctggatactatcgggatcataaaggcttgtataccggacggtgt
gttccctgcaattgcaacggacattcaaatcgatgccaggatggctcaggcatatgtgtt
aactgtcagcacaacaccgcgggagagcactgtgaacgctgccaggagggctactatggc
aacgccatccacggatcctgcagggcctgcccatgtcctcacaccaacagctttgccacc
ggctgtgtggtgagtgggggagacgtgcggtgctcctgcaaagctgggtacacaggaaca
cagtgtgaaaggtgtgcaccgggatatttcgggaatccccagaaattcggaggtagctgc
caaccatgcagttgtaacagcaatggccagctgggcagctgtgatcccctgactggagac
tgcataaaccaagaacccaaagatagcagccctgcagaagaatgtgatgattgcgacagc
tgtgtgatgaccctcctgaacgacctggccaccatgggcgagcagctccgcctggtcaag
tctcagctgcagggcctgagtgccagcgcggggcttctggagcagatgaggcacctggag
acccaggccaaggacctaaggaatcagttgctcaactaccgttctgccatttcaaatcat
ggatcaaaaatagaaggcctggaaagagaactgactgatttgaatcaggaatttgagact
ttgcaagaaaaggctcaagtaaattccagaaaagcacaaacattatacaacaatgttaat
cgggcaacacaaagcgcaaaagaactggatgtgaagattaaaaatgtcatccggaatgtg
cacattctcttaaagcagatctctgggacagatggagagggaaacaacgtgccttcaggt
gacttttccagagagtgggctgaagcccagcgcatgatgagggaactgcggaacaggaac
tttggaaagcacctgagagaagcagaagctgataaaagggagtcgcagctcttgctgaac
cggataaggacctggcagaaaacccaccagggggagaacaatgggcttgctaacagtata
cgggattctttaaatgaatacgaagccaaactcagtgaccttcatgctcggctgcaggag
gcagctgcccgagccaagcaggcaaatggcttgaaccaagaaaacgagagagctttggga
gccatccagagacaagtgaaagaaataaattccctgcagagtgatttcaccaagtatcta
accactgcagactcatctttgttgcaaaccaacattgcgctgcagctgatggagaaaagc
cagaaggaatatgaaaaattagctgccagtttaaatgaagcaagacaagaactaagtgac
aaagtaagagaactttccagatctgctggcaaaacatcccttgtggaggaggcagaaaag
cacgcgcagtccttacaagagctggcaaagcagctggaagagatcaagagaaacgccagc
ggggatgagctggtgcgctgtgctgtggatgccgccaccgcctacgagaacatcctcaat
gccatcaaagcggctgaggatgcggccaacagggctgccagtgcatctgaatctgccctc
cagacagtgataaaggaagatctgccaagaaaagctaaaaccctgagttccagcagtgat
aaactgttaaatgaagccaagatgacacaaaagaagctgaagcaagaagtcagtccggct
ctcaacaacctacagaaaaccctgaatattgtgacagttcagaaagaagtgatagacacc
aatctcacaactctccgagatggtcttcgtgggatacagagaggtgatattgatgcgatg
atcagtagtgcaaagagcatggtcagaaaggccaacgacatcacagatgaggtgctggat
gggctcagccccattcagacagatgtggaaagaattaaggacacctatgggagcacacag
aacgaagacttcaaaaaggctctgactgatgcagataactcggtgaacaagttaaccaac
aaactacctgatctttggcgcaagattgaaagtatcaaccaacagctgttgcccttggga
aacatctctgacaacatggacagaatacgagaactaattcagcaggccagagatgctgcc
aataaggttgctgtccccatgaggttcaatggtaaatctggagtcgaagtccgactgcca
aatgacctggaagatttgaaaggatatacatctctgtccttgtttctccaaaggcccaac
tcaagagaaaatgggggaactgagaatatgtttgtgatgtaccttggaaataaagatgcc
tcccgggactacattggcatggcagttgtggatggccagctcacctgtgtctacaacctg
ggggaccatgagactgaactccaagcggaccagatcttgaccaagagtgaaactaaggag
gcagttatggatcgggtgaaatttcagagaatttatcagtttgcaaggcttaattacacc
aaaggagccacatccagtaaaccagaaacacccggagtctatgacatggatggtagaaat
agcaatacactccttaatttggatcctgaaaatgttgtattttatgttggaggttaccca
cctgattttaaacttcccagtcgactaagtttccctccatacaaaggttgtattgaatta
gatgacctcaatgaaaatgttctgagcttgtacaacttcaaaaaaacattcaatctcaac
acaactgaagtggagccttgtagaaggaggaaggaagagtcagacaaaaattattttgaa
ggtacgggctacgctcaagttccaactcaaccacatgctcccatcccaacctttggacag
acaattcagaccaccgtggatagaggcttgctgttctttgcagaaaacagggatcgcttc
atatctctgaatatagaagatggcaagctcatggtgagatacaaactgaattcagagcca
ccaaaagagagaggagttggagacgccataaacaacggcagagaccattcgattcagatc
aaaattggaaaactccaaaagcgtatgtggataaatgtggatgttcaaaacactataatt
gatggtgaagtctttgatttcagcacatattatctgggaggaattccaattgcaatcagg
gaaagatttaacatttctacgcctgctttccgaggctgcatgaaaaatttgaagaaaacc
agtggtgtcgttagattgaatgatactgtgggagtaaccaaaaagtgctcggaagactgg
aagcttgtgcgatctgcctcattctccagaggaggacaattgagtttcactgatttgggc
ttaccacctactgaccacctccaggcctcatttggatttcagacctttcaacccagtggc
atattattagatcatcagacacagacaagcagcctgcaggtcactctggaagatggttac
attgaattgagcaccagggatagcagcggcccaatttttaaatctccacagacgtatatg
gatggtttactgcattatgtatctgtaataagggacaactctggactacggcttctcatc
gatgaccagcctctgagaaataacgaaaggctaaaacgcatttcaagttcccagcagtct
ctgcgtctgggcgggagcaattttgagggttgtattagcaatgtttttgtccagaggttg
tcactgagtcccgaagtcctagatttgaccagtaactctctcaagagagatgtgtccctg
ggaagctgcagtttaaacaaaccaccttttctaatgttgcttaaaggttctaccaggttt
aacaagaccaagactttccgtatcaaccagctgttgcaggacacaccggtggcctcccca
aggagcatgaaggtgtggcaagatgcttgctcaccacttcccaagacccaggccaatcat
ggagccctccagtttggggacattcccaccagccacttgctattcaagcttcctcaggag
ttgctgaaacccaggtcacagtttgctgtggacatgcagacaacatcctccagaggactg
gtgtttcacacgggcgctaagaactcctttatggctctttatctttcaaaaggacgtctg
gtctttgcactggggacagatgggaaaaaattgaggatcaaaagcaaggagaaatgcaat
gatgggaaatggcacacggtggtgtttggccatgatggagaaaaggggcgcttggttgtg
gatggactgagggcccgggagggaagtttgcctggaaactccaccatcagcatcagagca
ccagtttacctgggatcacctccatcagggaaaccaaagagcctccccacaaacagcttt
gtgggatgcctgaagaactttcagctggattcaaaacccttggataccccttcttcaagc
ttcggggtgtcttcctgcttgggtggtcctttggagaaaggcatttatttctccgaagaa
ggaggtcatgtcgtcttggctcactctgtattgttggggccagaatttaagcttgttttc
agcatccgcccaagaagtctcactggaatcctaatacacatcggaagtcagcccgggaag
cacttatgtgtttacctggaggcaggaaaggtcacggcctctatggacagtggggcaggt
gggacctcgacgtcagtcacaccaaagcagtctctgtgtgatggacagtggcactcggtg
gcagtcaccataaaacaacacatcctgcacctggaactggacacagacagtagctacaca
gctggacagatccccttcccacctgccagcactcaagagccactacaccttggaggtgct
ccagccaatttgacaacactgaggatccctgtgtggaaatcattctttggctgtctgagg
aatattcatgtcaatcacatccctgtccctgtcactgaagccttggaagtccaggggcct
gtcagtctgaatggctgtcctgaccactaa

KEGG   Pongo abelii (Sumatran orangutan): 100441462
Entry
100441462         CDS       T01416                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100441462 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100441462 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100441462 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441462 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100441462 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100441462 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100441462 (LAMC3)
   05145 Toxoplasmosis
    100441462 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 100441462
NCBI-ProteinID: XP_002820355
LinkDB
Position
9
AA seq 1575 aa
MAAAALLLGLALLALRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGTQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADSPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDAAGQLACRCQHNTTGTD
CEHCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTT
GPHCESCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKEKVEGNLCDRCRPGSFNLQPHNPAGCSSC
FCYGHSKVCAATAQFQVHHILTDFHQGAEGWWARSVGGPEHPPQWSPNGVLLSPEDEEEL
TAPDKFLGDQRFSYGQPLILTFRAPPGNSPLPVQLRLEGAGLALSLRHSSLSGPQDAGHP
REVELRFHLQETSEDVAPPLTPFHFQRLLANLTSLRLRISPGPSPAGQVFLTEVRLTSAR
PGLSPPASWVETCSCPSGYTGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESGEVVCTHCPPG
QRGRRCEVCDDGFFGDPLGLSGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTTG
DHCEHCQEGFYRSALVPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTGRDCSL
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFSIK
GCWACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCQECPSCYALV
KEEAAKLKARLTLMEGWLQGSNCGSPWGPLDILLGEAPRGDVYQGHHLLPGAQEAFLEQI
MGLEGAVKATREQLQRLSKGARCAQARSQKTCTQLADLEAVLESSEEEILHAAAILSTLE
IPQEGPSQPTKWSHLATEARALARSHRDTATKIAATARRALLASNTSYALLWNLLEGRVA
LETQRDLEDRYQEVQAAQKALGTAMAEVLPEAESVLATVQRIGTDTAPYLALLASLGALP
QKSRAEDLGLKAKALEKTVASQQHMATEAARTLQAAAQAALRQTGPLTQLHQEARAALTQ
ASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVSDRLLADTRRKTKQA
ERMLGNAAPLSSSAKKKGREAELLAKDSAKLAKALLREGKQAHRRASRLTSQTQATLQQV
SRQALASEAHRQELEEAERVGAGLSEMEQQIRESRISLEKDIEALSELLARLGSLDTHQA
PAQALNETQWALERLRLQLGSPGSLQRKLSLLEQESQQQELQIQGFESDLAEIRADKQNL
EAILHSLPENCASWQ
NT seq 4728 nt   +upstreamnt  +downstreamnt
atggcggcggctgcgctcctgctggggctggcgctgctggcactgcgggcggccggcgcg
ggcatgggcgcgtgctatgacggcgcggggcgcccgcagcgctgcctgccggtgttcgag
aacgcggcgtttgggcggctcgcccaggcctcgcacacgtgcggcagcccgcccgaggac
ttctgtccccacgtgggcgccgcgggcgcggggactcagtgccagcgctgcgacgccgcc
gacccccagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgttcagtaccccacctcggtcaacatc
accctccgcctggggaaggcttacgagatcacgtacgtgaggctaaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgcgccgacagcccatgggagccctac
cagttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgc
cccggcgaggacgagcgcgtggccttctgcacctctgagttcagcgacatctccccgctg
agtgggggcaatgtggccttctccaccctggagggccggcccagcgcctacaactttgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggacgacatcttcaaggaccccaaggtgctccagtcctactactat
gctgtgtccgacttctctgtgggtggcaggtgcaagtgcaacgggcatgccagcgagtgc
ggccccgacgcggcgggccagttggcctgccggtgccagcacaacaccaccggcacggac
tgtgagcactgcctgcccttctttcaggaccgcccttgggcccggggcaccgctgaggct
gcccacgaatgtctgccctgcaactgcagtggccgctccgaggaatgcacatttgatcgg
gaactcttccgcagcacaggccacggcgggcgctgtcaccactgccgtgaccacacaact
gggccacactgtgagagctgtcaggagaatttctatcactgggacccgcggatgccatgc
cagccctgtgactgccactcggcaggctccctacacctccagtgcgatgacacaggcacc
tgcgcctgcaagcccactgtgactggctggaagtgtgaccgctgtctgcccgggttccac
tcgctcagtgagggaggctgcagaccctgcacctgcaatcccgctggcagcctggacacc
tgtgacccccgcagtgggcgctgcccctgcaaagagaaggtggaaggcaacctatgtgac
agatgtcgacccgggtcctttaacctgcagccgcacaatccggccggctgcagcagctgt
ttctgctatggccactccaaggtgtgcgcggccactgcccagttccaggtgcatcacatc
ctcaccgatttccaccagggagccgaaggctggtgggccagaagtgtggggggccccgag
caccccccacaatggagcccaaatggggtcctcctgagcccagaagatgaggaggagctt
acagcaccagataagttcctgggagaccaacggttcagctacgggcagcccctcatcctg
accttccgggcgccccctgggaactccccactccctgtgcagctgaggctggaaggggca
ggcttggccctgtccctgaggcactctagcctgtctggcccccaggatgctgggcatccc
agggaggtagagctcaggttccacctgcaggagacctccgaggacgtggcccctccactc
acccccttccacttccagcggctgctcgccaacctgaccagcctccgcctccgcatcagt
ccgggccccagccctgccggccaagtgttcctgactgaggtccggctcacatccgcccgg
ccagggctttccccgccagcctcctgggtggagacttgttcatgtcccagtggctacacg
ggccagttctgtgaatcctgtgctccgggatacaagagggagatgccacaggggggtccc
tatgccagctgtgtcccctgcacctgtaaccagcatggcacctgtgaccccaacacaggg
atctgcgtctgcagccaccataccgagggcccatcctgtgaacgctgcttgccaggtttc
tatggcaaccctttcgcgggccaagctgacgactgccagccctgtccctgccctggccag
tcggcctgcacgaccatcccagagagcggggaggtggtgtgcacccactgccccccgggc
cagagagggcggcgctgtgaggtctgtgatgatggtttttttggggacccgctggggctc
tctgggcatccccagccctgccaccagtgccagtgcagcgggaacgtggaccccaatgcc
gtgggcaactgtgaccccctgtctggccactgcctgcgctgcctgcacaacaccacgggt
gaccactgtgagcactgtcaggaaggcttctacaggagcgccctggtccctcggcccgca
gacaaatgcatgccttgcagctgtcacccacagggctcggtcagtgagcagatgccctgc
gacccagtgacaggccaatgctcctgcctgcctcacgtgactggacgggactgcagcctc
tgctaccctggcttcttcgacctgcagcctgggaggggctgccggagctgcaagtgtcac
ccactgggctcccaggaggaccagtgccatcctaagactggacagtgcacctgccgccca
ggtgtcacaggccaggcctgtgacagatgccagctgggtttcttcggcttctccatcaag
ggctgctgggcctgcaggtgctccccactgggcgctgcctccgcccagtgccacgagaac
ggcacatgcgtgtgcaggcctggcttcgagggctacaaatgtgaccgctgccacgacaac
ttcttcctcacggcagacggcacacactgccaggaatgtccgtcctgctacgccctggtg
aaggaggaggcagccaagctgaaggccagactgactttgatggaggggtggctgcaaggg
tccaactgtggcagtccctggggaccactagacattctgctgggagaggccccaaggggg
gacgtctaccagggccaccacctgcttccaggggctcaggaagccttcctggagcagatc
atgggcctcgagggtgctgtgaaggccacccgggagcagctgcagaggctgagcaagggt
gcccgctgtgcccaggccagatcccagaagacctgcacccagctggcagacctggaggca
gtgctggagtcctctgaagaggagattctgcacgcagctgccattctctcaactctggag
attcctcaggaaggtcccagtcagccgaccaaatggagccacctggccacagaggcccgt
gccctcgccaggagccacagagacaccgccaccaagatcgcagccactgctcggagggcc
ctgctcgcctccaataccagctacgcgcttctctggaatctgctggagggaagggtggct
ctagagacccagcgggacctggaggacaggtaccaggaggtccaggcggcccagaaagca
ctggggacggctatggcagaggtgctgcctgaagcggaaagcgtgttggccaccgtgcag
cgaattggcacagatacagccccgtacctggccttgctggcttccctgggagctctgcct
cagaagtcccgggctgaagacctgggcctgaaggcgaaggccctggagaagacagttgca
tcacaacagcacatggccactgaggctgcccgaaccctccaggctgctgcccaggcggcg
ctacggcaaacaggacccctcacacagctgcatcaggaggccagagccgccctgacccag
gcttcctcgtctgtccaggctgccacagtgaccgtcatgggagccaggactctgctggct
gacctggaaggaatgaagctgcagtttccccggcccaaggaccaggcggcattgcagaga
aaggcagactccgtcagcgacagactccttgcagacacgagaaggaagaccaagcaggcg
gagaggatgctgggaaatgcggcccctctttcctccagtgccaagaagaagggcagagaa
gcagagctgttggccaaggacagtgccaagcttgccaaggccttgctgagggaggggaaa
caggcgcaccgccgtgccagccggctcaccagccagacgcaagccacgctccaacaggtg
tcccggcaggcgctggcgtctgaagcacacagacaggagctggaggaagctgagcgggtg
ggtgctgggctgagcgagatggagcagcagatccgggaatcgcgtatctcactggagaag
gacatcgaggccttgtcagagctgcttgccaggctggggtcgctggacacccatcaagcc
ccagcccaggccctgaacgagactcagtgggcactagaacgcctgaggctgcagctgggc
tctccggggtccttgcagaggaaactcagtctgctggagcaggaatcccagcagcaggag
ctgcagatccagggcttcgagagtgacctcgccgagatccgcgccgacaaacagaacctg
gaggccattctgcacagcctgccggagaactgtgccagctggcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100441641
Entry
100441641         CDS       T01416                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta-2 isoform X1
  KO
K06243  laminin, beta 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100441641 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100441641 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100441641 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441641 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100441641 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100441641 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100441641 (LAMB2)
   05145 Toxoplasmosis
    100441641 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C Sec5
Other DBs
NCBI-GeneID: 100441641
NCBI-ProteinID: XP_024100812
Ensembl: ENSPPYG00000013880
LinkDB
Position
3
AA seq 1802 aa
MELTSREGGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPVPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGYSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPG
STPCDPSSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQVPYRCDE
ATGQCHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTLGETPSWTG
SGFVRLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGH
LVAKDDRIQGTLQPHARYMMFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLID
SLVLLPHVLVLEMFSGGDAAALERRATFERYQCHEEGLVPSKTSPSEACAPLLISLSTLI
YNGALPCQCNPQGSLSSECNPHGGQCLCKPGVVGRCCDLCASGYYGFGPTGCQACQCSHE
GALSSLCEKTSGQCPCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGC
RDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQQIVCHC
RAGYTGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEG
PHCAHCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSC
DRCAPNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDP
GLQCRACDCDSRGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGD
WDRVVQDLAARTRRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTA
QLVEATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSGLERDRIALNLTLRQLHQ
HLDLLKHSNFLGAYDSIRHAHRQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQK
EDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGASCRDEDGQPR
CGGLSCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALD
KANASRGQVEQANQELRELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLA
SAIAERVRSLADVDAILARTVGDVRRAEQLLQDARRARSRAEDEKQKAETVQEALEEAQR
AQGVAQGAIRGAVADTQDTEQTLYQVQERMAGAEQALSSAGERARQLDALLEALKLKRAG
NSLAASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRD
EARDLLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNT
CQ
NT seq 5409 nt   +upstreamnt  +downstreamnt
atggagctgacctcaagggaaggagggaggggacagcctctgccctgggaacttcgactg
ggcctactgctaagcgtgctggctgccacactggcacaggcccctgccccggatgtgcct
ggctgttccaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacctgtggcctgaatggcccccagccctattgcatcgtcagt
cacctgcaggacgaaaagaagtgcttcctttgtgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaatgtagtcaccagctttgcaccacagcggcgg
gcagcctggtggcagtcagagaatggtatccctgcggtcaccatccagctggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcccccccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgt
gtgctggaccctgccatccctgtcccagacccctacagctcacggattcagaacctgttg
aagatcaccaacctacgggtgaacctgactcgtctacacacgttgggagacaacctactc
gacccacggagggagatccgagagaagtactactatgccctctatgagctggttgtacgt
ggcaactgcttctgctacggacacgcctcagagtgtgcacccgccccaggggcaccagcc
catgccgagggcatggttcacggagcttgcatctgcaaacacaacacacgtggcctcaac
tgtgagcagtgtcaggatttctatcatgacctgccctggcatccagctgaggacggctat
agtcatgcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatg
gccgtatacctggcatctggcaacgtgagtggaggtgtgtgtgatggatgtcagcataac
acagctgggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaggac
ctgcgggatccggctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggt
ggtcgctgtgattcccatgatgaccctgcactgggactggtctccggccagtgtcgctgc
aaagaacatgtggtgggcactcgctgccagcaatgccgtgatggcttctttgggcttagc
atcagtgaccctctgggctgccggcgatgtcaatgtaatgcacggggcacagtgcctggg
agcactccttgtgaccccagcagtggatcctgttactgcaaacgtctagtgactggacgt
ggatgtgaccgctgcctgcctggccactggggcctgagccacgacctgcttggctgccgc
ccctgtgactgcgacgtgggtggtgccttggatccccaagttccctacaggtgtgatgag
gccacaggtcaatgccactgccgccagcacatggttgggcgacgctgtgagcaggtgcaa
cctggctacttccggcccttcctggaccacctaatttgggaggctgaggacacccgaggg
caggtgctcgatgtggtggagcgcctggtgacccttggggaaactccatcctggactggc
tcaggctttgtgcggctacaggaaggtcagaccctggagttcctggtggcctctgtgccg
aaggccatggactatgacctgctgctgcgcttagagccccaggtccctgagcaatgggca
gagttggaactgattgtgcagcgtccagggcctgtgcctgcccacagcctgtgtgggcat
ttggtggccaaggatgaccgcatccaagggactctgcaaccacacgccaggtacatgatg
tttcctaatcctgtctgccttgagcctggtatctcctacaagctgcatctgaagctggta
cggacagggggaagtgcccagcctgagactccctactctggacctggcctgctcattgac
tcgctggtgctgctgccccatgtcctggtgctagagatgtttagtgggggtgatgctgct
gccctggagcgccgggccacctttgaacgctaccaatgccatgaggagggtctggtgccc
agcaagacttctccctctgaggcctgcgcgcccctcctcatcagcctgtccacccttatc
tacaatggtgccctgccatgtcagtgcaaccctcaaggttcactgagttctgagtgcaac
cctcatggtggtcagtgcctgtgcaagcctggagtggttgggcgctgctgtgacctctgt
gcctctggctactatggctttggccccacaggctgtcaagcctgccagtgcagccatgag
ggggcactcagcagtctctgtgaaaagaccagtgggcaatgtccctgtcgaactggtgcc
tttgggcttcgctgtgaccgctgccagcgtggccagtggggattccctagctgccggcca
tgtgtctgcaatgggcatgcagatgagtgcaacacccacacaggcgcttgcctgggctgc
cgtgatcacacagggggtgagcactgtgaaaggtgcattgctggtttccatggggaccca
cggctgccatatgggggccagtgccggccctgtccctgtcctgaaggccctgggagccaa
cggcactttgctacttcttgccaccgggatgaatattcccagcagattgtgtgccactgc
cgggcaggctacacggggctgcgatgtgaagcttgtgcccctgggcactttggggaccca
tcaaggccaggtggccggtgccaactgtgtgagtgcagtgggaacattgacccaatggat
cctgatgcctgtgacccccacacggggcaatgcctgcgctgtttacaccacacagagggt
ccacactgtgcccactgcaagcctggcttccatgggcaggctgcccgacagagctgtcac
cgctgcacatgcaatctgctgggcacaaatccccagcagtgcccatctcctgaccagtgc
cactgtgatccaagcagtgggcagtgcccatgcctccccaatgtccagggccctagctgt
gaccgctgtgcccccaacttctggaacctcaccagcggccatggttgccagccttgtgcc
tgccacccaagccgggccagaggccccacctgcaatgagttcacagggcagtgccactgc
cgtgcaggctttggagggcggacttgttctgagtgccaagagctccactggggagaccct
gggttgcagtgccgtgcctgtgattgtgactctcgtggaatagatacacctcagtgtcac
cgctccacaggccactgcagctgccgcccaggggtgtctggtgtgcgctgtgaccagtgt
gcccgtggcttctcaggaatctttcctgcctgccatccctgccatgcatgcttcggggat
tgggaccgagtggtgcaggacttggctgcccgtacacggcgcctagagcagcgggcgcag
gagttgcagcagacgggtgtgctgggtgcctttgagagcagcttctggcatatgcaggag
aagctgggcattgtgcagggcatcgtaggtgcccgcaacacctcagccgcctccaccgca
cagcttgtggaggccacagaggagctgcggcgtgaaattggggaggccactgagcacctg
actcagctcgaggcagagctgacagatgtgcaagatgagaacttcaatgccaaccatgca
ctaagcggtctggagcgagacaggattgcacttaatctcacactgcggcagctccaccag
catcttgacttgctcaaacattcaaacttcctgggtgcctatgacagcatccggcatgcc
cataggcagtctgcagaggcagaacgtcgtgccaatacctcagccctggcagtacctagc
cctgtgagcaattcggcaagtgctcggcatcggacagaggcactgatggatgctcagaag
gaggacttcaacagcaaacacatggccaaccagcgggcactcggcaagctctctgcccat
acccacaccctaagcctaacagacataaatgagctggtgtgtggggcaccaggggatgca
ccctgtgctacaagcccttgtgggggtgccagctgtcgagatgaggatgggcagccccgc
tgtgggggcctcagctgcaatggggcagcggctacagcagacctagcactgggccgggcc
cggcacacacaggcagagctgcagcgggcactggcagaaggtggtagcatcctcagcaga
gtggctgagactcgtcggcaggcaagcgaggcacagcagcgggcccaggcagccctggac
aaggctaatgcttccaggggacaggtggaacaggccaaccaggaacttcgagaacttatc
cagagtgtgaaagacttcctcaaccaggagggggctgatcctgatagcattgaaatggtg
gccacacgggtgctagagctctccatcccagcttcagctgagcagatccagcacctggca
agtgcaattgcagagcgagtccggagcctggcggatgtggacgcgatcctggcacgtact
gtaggagatgtgcgtcgtgccgagcagctactgcaggatgcacggcgggcaaggagccgg
gctgaggatgagaaacagaaggcagagacagtacaggaagcactggaggaggcccagcgg
gcacagggtgttgcccagggtgccatccggggggcagtggctgacacacaggacacagag
cagaccctgtaccaggtacaggagaggatggcaggtgcagagcaggcactgagctctgca
ggtgaaagggctcggcagttggatgctctcctggaggctctgaaattgaaacgggcggga
aatagtctggcagcctctacagcagaagaaacagcaggcagtgcccagggtcgtgcccag
gaggctgagcagctgctacggggccctctgggtgatcagtaccagacggtgaaggccctg
gctgagcgcaaggcccagggtgtgctggctgcacaggcaagggcagaacaactgcgggat
gaggctcgggacctgttgcaagccgctcaggacaagctgcagcggctacaggaattggaa
ggcacctatgaggaaaatgagcgggcactggagagtaaggcagcccagctggacgggttg
gaggccaggatgcgcagcgtgcttcaagccatcaacttgcaggtgcagatctacaacacc
tgccagtga

KEGG   Pongo abelii (Sumatran orangutan): 100443710
Entry
100443710         CDS       T01416                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain
  KO
K06237  collagen type IV alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04974  Protein digestion and absorption
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100443710 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100443710 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100443710 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100443710 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    100443710 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100443710 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100443710 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100443710 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100443710 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100443710 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100443710 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100443710 (COL4A4)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100443710 (COL4A4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100443710 (COL4A4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100443710
NCBI-ProteinID: XP_024098889
Ensembl: ENSPPYG00000013236
LinkDB
Position
2B
AA seq 1684 aa
MWSLHIVLMRYSFGLTKSLATGPWSLILILFSVQYVYGSGKKYVGPCGGRDCSVCHCVPE
KGSRGPPGPPGPQGPIGPLGAPGPIGLSGEKGMRGDRGPPGAAGDKGDKGPTGVPGFPGL
DGIPGHPGPPGPRGKPGMSGHNGSRGDPGFLGGRGALGPGGPPGHPGEKGEKGNSVFILG
AIKGIQGDRGDPGLPGLPGFWGAGGPAGPTGYPGEPGLVGPPGQPGRPGLKGNPGVGIKG
QMGDSGEVGQQGSPGPTLLVEPPDFCLYKGEKGIKGIPGMIGLPGPPGRKGESGIGAKGE
KGIPGFPGPRGDPGSYGSPGFPGLKGELGLVGDPGLFGLIGPKGDPGNRGHPGPPGVLVT
PPLPLKGPPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACAGMIGPPGPQGFPGLPGLPG
EAGIPGRPDSAPGKPGKPGSPGLPGEPGLQGLPGSSATYCSVGNPGPQGIKGKVGPPGGR
GSKGEKGNEGLCACEPGPMGPPGPPGLPGRQGSKGDLGIPGWLGTEGDPGSPGAEGPPGL
PGKHGASGPPGNKGAKGDMVVSRVKGHKGERGPDGPPGFPGQPGSHGRDGHAGEKGDPGP
PGDHEDATPGGKGFPGPLGPPGKAGPVGPPGLGFPGLPGERGHPGVPGRPGVRGPDGLKG
QKGDTISCNVTYPGRQGPPGFDGPPGPKGFPGPQGAPGLSGSDGHKGRPGTPGTSEIPGP
PGFRGDMGDPGFGGEKGSSPVGPPGPPGSPGVNGQKGIPGDPAFGHLGSPGRRGLSGVPG
IKGPRGDPGCPGAEGPAGIPGFPGLKGPKGREGHAGFPGVPGPPGHSCERGAPGIPGQPG
LPGYPGGKGQPGDVGPPGPAGMKGLPGLPGRPGAHGPPGLPGIPGPFGDDGLPGPPGPKG
PQGLPGFPGFPGERGKPGAEGCPGTKGEPGEKGMSGFPGDRGLRGAKGAIGPPGDEGEMA
IISQKGTPGEPGPPGDDGFPGERGDKGTPGMQGRRGEPGRYGPPGFHRGQPGEKGQPGPP
GPPGPPGSMGLRGFIGFPGLPGDQGEPGSPGPPGFSGIDGARGPKGNKGDPASHFGPPGR
KGEPGSPGCPGHFGASGEQGLPGIQGPRGSPGRPGPPGSSGPPGCPGDQGMPGLRGQPGE
MGDPGPRGLQGDPGIPGPPGIKGPSGSPGLNGLHGLKGQKGTKGASGLHDVGPPGPVGIP
GLKGERGDPGSPGISPPGPYGEKGPPGPPGRSGPPGPAGATGRAPKDIPDPGPPGDQGPP
GPDGPRGAPGPPGLPGSVDLLRGEPGDCGLPGPPGPPGPPGPPGYKGFPGCDGKDGQKGP
MGFPGPQGPHGFPGPPGEKGLPGPPGRKGPTGLPGPRGEPGPPADVDDCPRIPGLPGAPG
MRGPEGAMGLPGMRGPPGPGCKGEPGLDGRRGVDGVPGSPGPPGRKGDTGEDGYPGGPGP
PGPTGDPGPKGFGPGYLGGFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEGQEKAHNQD
LGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEAIRPYVSRC
VVCESPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDF
RAAPLLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVC
VKYS
NT seq 5055 nt   +upstreamnt  +downstreamnt
atgtggtctctgcacatagtactaatgaggtactccttcggattgaccaagtccttggcc
acaggtccctggtcacttatactcattctcttttctgtacaatatgtatatgggagtgga
aagaaatacgttggtccttgcggaggaagagattgctctgtttgccactgtgttcctgaa
aaggggtctcggggtccaccaggaccaccagggccacagggtccaattggacccctggga
gccccaggacccattgggctttcaggagagaaaggaatgagaggggaccgcggccctcct
ggagcagcaggggacaaaggagataagggtccaactggtgttcctggatttccaggttta
gatggcatacctgggcacccagggcctcctggacccagaggcaaacctggcatgagtggc
cacaatggctcaagaggtgacccagggtttctaggaggaagaggagctcttggcccagga
ggccccccaggccatcctggggaaaagggagaaaaaggaaattcagtgttcattttaggt
gccattaaaggtattcagggagacagaggggacccaggactgcctggcttaccaggattt
tggggtgcaggaggaccagcgggccccacaggatatcctggagagccagggttagtggga
cctccgggccaaccagggcgtccaggtttgaagggaaatcccggtgtgggaataaagggg
caaatgggagactcgggtgaggttggtcagcaaggttctcctggacccaccctgttggta
gagccacctgacttttgtctctataaaggagaaaagggtataaaaggaattcccggaatg
attggactgccaggaccaccaggacgcaagggagaatccggtattggggcaaaaggagaa
aaaggtattcccggatttccagggcctcggggggatcctggttcctatggatctccaggt
tttccaggattaaagggagaactaggactggttggagatcctgggctatttggattaatt
ggcccaaagggggatcctggaaatcgagggcacccaggaccaccaggtgttttggtgact
ccacctcttccactcaaaggcccaccaggggacccagggttccctggccgctatggagaa
acaggggatgttggaccacctggtcccccaggtctcttgggcagaccaggggaagcctgt
gcaggcatgataggaccccctgggccacaaggatttcctggtcttcctgggcttccagga
gaagctggtattcctgggagacctgattctgctccaggaaaaccagggaagccaggatca
cctggcttgcctggagaaccaggcctgcagggcctcccaggatcaagtgcgacatactgc
agtgttgggaaccctggaccacaaggaataaaaggcaaagtgggtcccccaggaggaaga
ggctcaaaaggagaaaaaggaaatgaaggactctgtgcctgtgagcctggtcccatgggc
ccccctgggcctccaggacttcctgggaggcaggggagtaagggagacttggggatccct
ggctggcttggaacagaaggtgacccgggatctcctggtgctgaaggacctccagggcta
ccaggaaagcatggtgcctccggaccacctggcaacaaaggggcaaagggtgacatggtt
gtatcaagagttaaagggcacaaaggagaaagaggtcctgatgggcccccaggatttcca
gggcagccaggatcacatggtcgggatggacatgctggagaaaaaggggatccaggaccc
ccaggggatcatgaagatgcgaccccaggtggtaaaggatttcctggacctctgggcccc
ccgggcaaagcaggacctgtggggcccccaggactgggatttcctggtctaccaggagag
cgaggccacccaggagttccaggccgcccaggtgtgaggggccctgatggcttgaagggt
cagaaaggtgacacaatttcttgcaacgtaacctaccctgggaggcaaggccctccaggt
tttgatggacctccaggtccaaagggatttccaggtccccaaggtgcccccgggctgagt
ggttcagatggacataaaggcagacctggcacaccaggaacatcggaaataccaggtcca
cctggttttcgtggtgacatgggagatccgggttttggaggtgaaaaggggtcctcccct
gttgggcccccaggccctcccgggtcaccaggagtgaatggtcagaaaggaatcccggga
gaccctgcatttggtcacctgggatccccaggaaggaggggtctttcaggagtgccaggg
ataaaaggacccagaggtgatccgggatgtccaggggctgaagggccagctggcattcct
ggattcccaggtctcaaaggtcccaaaggcagagagggacatgctgggtttccaggtgtc
ccaggtccgcctggccattcctgtgaaagaggtgctccagggataccagggcaaccggga
ctccctgggtatccaggtgggaaaggacagccgggagatgtggggcctcccgggccagct
ggaatgaaaggtctccccggactcccaggacggcctggggcacatggtcccccaggcctc
ccaggaatcccaggtccttttggggatgatgggctacccggtcctccaggtccaaaggga
ccccaggggctgcctggtttcccaggttttcccggagaaagaggaaagcctggtgcagag
ggatgtcctggcacaaagggagaacctggagagaagggcatgtctggctttcccggagac
cggggactgagaggagccaaaggagccataggacctcccggagatgaaggagaaatggct
atcatttcccaaaagggaacacctggggaacctggacctcctggagatgatggattccca
ggagaaagaggtgataaaggaactcccgggatgcaagggagaagaggagagccgggaaga
tacggaccacctggatttcacagagggcaacctggcgagaaaggtcagccagggcctcct
ggacccccaggccctccaggctcaatgggtctaagagggttcattggttttccaggactt
ccaggtgaccagggtgagccaggttctccaggtccccctggattttcaggaattgatgga
gcaagaggacctaaaggaaacaaaggtgaccctgccagtcactttggtccacctggtcga
aagggtgagccaggtagccctggatgtccagggcattttggagcatccggagagcagggc
ttgcctggcattcaagggcccagaggatcacccggaaggccagggccacctggctcctct
ggaccaccagggtgcccaggtgatcaggggatgcctgggctgaggggacagccaggagaa
atgggagaccctgggccaagaggcctccagggggatccagggataccaggtcctccggga
ataaaaggtccctccggatcacctggtctaaacggcttgcatggattgaagggtcagaaa
ggaaccaaaggtgcttcaggtttgcatgatgtggggccacctggtccagtgggaatacct
gggctaaaaggggagagaggagatcctgggagcccaggaatctctcctccaggtccttat
ggagaaaaaggtcccccaggtcccccagggagatcaggaccacctggtcctgcaggtgcc
acaggaagagctcctaaggacattcctgacccgggtccacctggagatcagggacctcct
ggtcctgatggcccaagaggagcacctgggcctccaggcctccctgggagtgttgacctt
ctgagaggggagccaggtgactgtggtctaccagggccaccaggtccccctggcccacca
ggccctccaggatacaaaggctttccaggatgcgatggaaaagatggccagaaaggacca
atgggattcccggggccgcagggaccacatggatttcctgggccacctggagagaagggt
ttacctggacctccagggagaaaagggcccactggtcttccaggtcccagaggtgaacca
gggccacctgcagatgtggatgactgtccccgaatcccaggccttcctggggcaccaggc
atgagaggaccagaaggagccatggggctccctggaatgagaggccccccaggaccaggg
tgcaaaggagagcctgggctggatggcaggaggggtgtggatggcgtccctgggtctcct
gggcctcctggacgtaaaggtgacacaggagaagacggctaccctggaggaccagggcct
cctggtcccactggggatcctgggcccaaagggtttggccctggatacctcggtggcttc
ctcctggttctccacagtcagacggaccaggagcccacctgccccctgggcatgcccagg
ctctggactgggtatagtctgttatacctggaagggcaagagaaagctcacaatcaagac
cttggtctggcaggttcttgccttcccgtgtttagcacactgccctttgcctactgcaac
atccaccaggtgtgccactatgcccagagaaacgacagatcctactggctggccagtgct
gcgcccctccccatgatgccactctctgaagaggcgatccgcccctatgtcagccgctgt
gtggtatgcgagtccccggcccaggcggtggcggtgcacagccaggaccagtccatcccc
ccatgtccgcagacctggaggagcctctggatcgggtattcattcctgatgcacacagga
gctggggaccaaggaggagggcaggccctcatgtcacctggcagctgcctggaagatttc
agagcagcaccattgcttgaatgccaaggccggcagggaacttgccacttttttgcaaat
aagtatagcttctggctcacaacagtgaaagcagacttgcagttttcctctgctccagca
ccagacaccttaaaagaaagccaggcccaacgccagaaaatcagccggtgccaggtctgt
gtgaagtatagctag

KEGG   Pongo abelii (Sumatran orangutan): 100444077
Entry
100444077         CDS       T01416                                 

Gene name
COL4A3
Definition
(RefSeq) collagen alpha-3(IV) chain
  KO
K06237  collagen type IV alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04974  Protein digestion and absorption
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100444077 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100444077 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444077 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100444077 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    100444077 (COL4A3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444077 (COL4A3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100444077 (COL4A3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100444077 (COL4A3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100444077 (COL4A3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100444077 (COL4A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100444077 (COL4A3)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100444077 (COL4A3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100444077 (COL4A3)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100444077 (COL4A3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100444077
NCBI-ProteinID: XP_024098890
Ensembl: ENSPPYG00000013237
LinkDB
Position
2B
AA seq 1670 aa
MSPRTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSP
GQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGITGLPGFSGSPGLPGTPGNTGPYGLV
GVPGCNGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKGEDIELDAKGDPGLPGAPG
PQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGP
PGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGPQGKPG
KDGVPGFPGSEGVKGNRGFPGITGEDGIKGQKGDIGLPGFRGPTEYYDTHQEKGDEGTPG
PPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGLPGKDAMGTPGSP
GCPGSPGLPGSPGPPGPPGGIVFRKGPPGDRGLPGYLGSPGIPGVDGPKGEPGLLCTQCP
YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEK
GETLQPEGQVGAPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGD
PGSPGSPGPTGPAGPPSYGPQGEPGPQGTQGAPGAPGPPGEAGPRGELSVSTPVPGLPGP
PGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSL
GCPGKMGEPGLPGKPGLPGTKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPG
TPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRIGKTGSKGD
PGIPGLDRSGFPGETGSPGMPGHQGEMGPPGQKGYPGNPGILGPPGEDGVIGMMGFPGAI
GPPGPPGNPGMPGQRGSPGIPGVKGHRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLK
GFTGNPGEKGNRGIPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGELGLRGIPGSMGNR
GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG
KKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGFLGPPGIRGPPG
LPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLGAPPGPRGNPGAQGAKGDRGAPGFP
GLPGRKGVMGDAGPRGPTGIEGFPGPPGLPGAMIPGQKGNHGPPGSRGSPGEPGPPGPPG
SHVIGIKGDKGSMGHPGPKGPPGTVGDMGPPGHLGAPGTPGLPGLRGDPGFQGFPGVTGE
KGNPGFLGSIGPPGPIGPKGPPGIRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP
PGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKGEPGPPGSDGLPGLKGKRGDSGSPAT
WTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTM
PFLFCNVNDVCNFASRNDYSYWLSTPALMPMDMAPITGRALEPYISRCTVCEGPAIAIAV
HSQSTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRG
TCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH
NT seq 5013 nt   +upstreamnt  +downstreamnt
atgagcccccggacggcccccaggccgcaggtgctcctactgccgctcctgctggtgctc
ctggcggcggcgcccgcagccagcaagggctgtgtctgtaaagacaaaggccagtgcttc
tgtgatggggccaaaggggagaagggggagaaaggctttcctggaccccccggttctcct
ggccagaaaggattcacaggtcctgaaggcttacctggaccacagggacccaagggcttt
ccaggacttccaggactcacgggttccaaaggtgtaaggggaataactggattgccagga
ttttccggttctcctggacttccaggcaccccaggcaatactgggccttatggacttgtc
ggtgtaccaggatgcaatggttctaagggtgagcaggggtttccaggactcccagggaca
ctgggctacccagggatcccgggtgctgctggtttgaaaggacaaaagggtgctcctgct
aaaggagaagatatagaacttgatgcaaaaggcgaccccgggttgccaggggctccagga
ccccagggtttgccaggccctccaggttttcctgggcctgttggcccacctggtcctccg
ggattctttggctttccaggagccatgggacctagaggacctaagggtcacatgggtgaa
agagtgataggacataaaggagagcggggtgtgaaagggttaacaggacccccgggacca
ccaggaacagttattgtgaccctaactggcccagataacagaacggacctcaagggggaa
aagggagacaagggagcaatgggcgagcctggacctcctggaccctcaggactgcctgga
gaatcatatggatctgaaaagggtgctcctggagaccctggcccacagggaaaacccgga
aaagatggtgttcctggcttccctggaagtgagggagtcaagggcaacaggggtttccct
gggataacgggtgaagatggcattaagggacagaaaggggacattggccttccaggattt
cgtggtccaacagaatattatgacacacaccaggaaaagggagatgaaggcactccaggc
ccaccagggcccagaggagctcgtggcccacaaggtcccagtggtccccccggagttcct
ggaagtcctggatcttcaaggcctggcctcagaggagcccctggatggccaggcttgaaa
ggaagtaaaggggaacgaggcctcccaggaaaggatgccatggggactcctgggtcccca
ggttgtcctggttcaccaggccttccaggatcaccgggacctccaggaccaccaggtggt
attgtttttcgcaagggtccacctggagatcgtggactgccaggctatctagggtctcca
ggaatcccaggagttgacgggcccaaaggagaaccaggcctcctgtgtacacagtgccct
tatatcccagggcctcccggtctcccaggattgccagggttacatggtgtaaaaggaatc
ccaggaagacaaggtgcagctggcttgaaaggaagcccagggtccccaggaaatacaggt
cttccaggatttccaggtttcccaggtgcccagggtgacccaggacttaaaggagaaaaa
ggtgaaacacttcagcctgaggggcaagtgggtgccccaggtgacccggggctcagaggc
caacctgggagaaagggcttggatggaattcctggaactccgggagtgaaaggattacca
ggacctaaaggcgaactggctctgagtggtgagaagggggaccaaggtcctccaggggat
cctggctcccctgggtccccaggacctacaggaccagctggaccacctagctacggaccc
caaggagaacctggtcctcagggcacgcaaggagctcctggagcccctggaccacccgga
gaagccggccctaggggagagctcagtgtttcaacaccagttccaggcctaccaggacct
ccagggccccctggccatcctggcccccaaggtccacctggtatccctggatccctgggg
aaatgtggagatcctggtcttccagggcctgatggtgaaccaggaattccaggaattgga
tttcctgggcctcctggacctaaaggagaccaaggttttccgggtacaaaaggatcactg
ggttgtcctggaaaaatgggagagcctgggttacctggaaagccaggcctcccaggaacc
aagggagaaccagcagtagccatgcctggaggaccaggaacaccaggttttccaggagaa
agaggcaattctggggaacatggagaaattggactccctggacttccaggtctccctgga
actccaggaaatgaagggcttgatggaccacgaggagatccagggcagcctggaccacct
ggagaacaaggacccccaggaaggtgcatagagggtcccaggggagcccaaggacttcca
ggcttaaatggattgaaagggcaacaaggcagaataggtaaaacagggtcaaagggagac
ccaggaattccaggcttggatagatcaggatttcctggagaaactggatcaccaggaatg
ccaggtcatcaaggcgagatgggaccaccgggtcaaaaaggatatccaggaaatccggga
attttagggccaccaggtgaagatggagtgattgggatgatgggctttcctggagccatt
ggtcctccggggccccctgggaacccaggcatgccagggcagagggggagccctggaatt
ccaggagtaaaaggccatagaggaaccccaggagccaagggggaacaaggagataaagga
aatcccgggccttctgagatatcccacgtaataggggacaaaggagaaccaggtctcaaa
ggattcacaggaaatccaggtgagaaaggaaacagaggcattccagggatgccaggttta
aaaggcctcaaaggactacctggaccagcaggaccaccaggccccagaggagatttgggc
agcactgggaatcctggagaactaggactgcgtggtataccaggaagcatggggaacagg
ggcatgccaggttctaaaggaaaaaggggaactctgggattcccaggtcgagcaggaaga
ccaggcctcccaggtattcacggtctccagggagataagggagagccaggttattcagaa
ggtacaaggccaggaccaccgggaccaacgggggatccaggactgccgggtgatatggga
aagaaaggagaaatggggcaacctggcccacctggacatttggggcctgctggacctgag
ggagcccctggaagtcctggaagtcctggcctcccaggaaagccaggtcctcatggtgat
ttgggttttaaaggaatcaaaggcttcctgggccctccaggaatcagaggccctccaggt
cttccaggattcccaggatctcctggaccaatgggtataagaggtgaccaaggacgtgat
ggaattcctggtccagccggagaaaagggagaaacgggtttattgggggcccctccaggc
ccaagagggaaccctggtgctcaaggagccaaaggagacaggggagccccaggttttcct
ggcctcccaggcagaaaaggggtcatgggagatgctgggcctcgagggcccacaggcata
gaaggattcccagggccaccaggtctgcccggtgcaatgatccctggccagaaaggaaat
catggtccaccaggctcaagaggaagcccaggtgagcctggtccccctggacctccaggg
agtcacgtaataggcataaaaggagacaaagggtctatgggccaccctggcccgaaaggt
ccacctggaactgtaggagacatgggaccaccaggtcatctgggagcaccaggtactcca
ggtcttccaggacttagaggtgatcctggattccaggggtttccaggcgtgacaggagaa
aagggtaatcctggatttctaggatccattggacctccaggaccaattgggccaaaagga
ccacctggtatacgtggagaccctggcacacttaagattatctcccttccaggaagccca
gggccacctggcacacctggagaaccagggatgcagggagaacctgggccaccagggcca
cctggaaacctaggaccctgtgggccaagaggtaagccaggcaaggatggaaaaccagga
actcctggaccagctggagaaaaaggcaacaaaggttctaaaggagagccaggaccacct
ggatcagatggattgccaggtttgaaaggaaaacgtggagacagtggatcacctgcaacc
tggacaacgagaggctttgtcttcacccgacacagtcaaaccacagcaattccttcatgt
ccagaggggacagtgccactctacagcgggttttcttttctttttgtacaaggaaatcaa
cgagcccacggacaagaccttggaactcttggcagctgcctgcagcgatttaccacaatg
ccattcttattctgcaatgtcaatgatgtatgtaatttcgcatctcgaaatgattattca
tactggctgtcaacaccagctctgatgccaatggacatggctcccattactggcagggcc
cttgagccttacataagcagatgcactgtttgtgaaggtcctgcgatcgccatagccgtt
cacagccaaagcactgacattcctccatgtcctcacggctggatttctctctggaaagga
ttttcattcatcatgttcacaagtgcaggttctgagggcaccgggcaagcactggcctcc
cctggctcctgcctggaagaattccgagccagcccatttctagaatgtcatggaagagga
acgtgcaactactattcaaattcctacagtttctggctggcttcattaaacccagaaaga
atgttcagaaagcctattccatcaactgtgaaagctggggaattagaaaaaataataagt
cgctgtcaggtgtgcatgaagaaaagacactga

KEGG   Pongo abelii (Sumatran orangutan): 100444160
Entry
100444160         CDS       T01416                                 

Gene name
COL4A1
Definition
(RefSeq) collagen alpha-1(IV) chain
  KO
K06237  collagen type IV alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04974  Protein digestion and absorption
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100444160 (COL4A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100444160 (COL4A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444160 (COL4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100444160 (COL4A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    100444160 (COL4A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444160 (COL4A1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100444160 (COL4A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100444160 (COL4A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100444160 (COL4A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100444160 (COL4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100444160 (COL4A1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100444160 (COL4A1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100444160 (COL4A1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100444160 (COL4A1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100444160
NCBI-ProteinID: XP_024086740
Ensembl: ENSPPYG00000005496
LinkDB
Position
13
AA seq 1669 aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGI
PGNPGPPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPP
GVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGG
PGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPGIVIGTGPLGEKGERGYPGTPGPRGEPGP
KGFPGLPGQPGPPGLPVPGQAGAPGFPGERGEKGDRGFPGTSLPGPSGRDGLPGPPGSPG
PPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGLIGEIGEKGQKGESCLICDIDGYRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQPGAKGEPGEIYFDLRLK
GDKGDPGFPGQPGMPGRAGSPGRDGHPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDT
GPPGPPGYGPTGPIGDKGQAGFPGGPGSPGLPGPKGEPGKVVPLPGPPGAEGLPGSPGFP
GPQGDRGFPGTPGRPGLPGEKGAVGQPGIGFPGPPGPKGVDGLPGDMGPPGTPGRPGFDG
LPGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPGVPGEHGAIGPPGLQGI
RGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGIKGEKGFPGFPGLDMPG
PKGDKGAQGLPGITGQSGLPGLPGQQGAPGIPGFPGSKGEMGVMGTPGQPGSPGPVGAPG
LPGEKGDHGFPGSSGPRGDPGFKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIG
PIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPG
TPGEKGVPGIPGLQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGE
KGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGT
PGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAKGDKGSKGEVGFPGLAGSP
GIPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGDRGPQGQPGLPGLPGPMGPPGLPG
IDGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKG
LPGLQGIKGDQGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLKGLQGLPGPK
GQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPAGPTGPRGFPGPPGPDGLPGSMGPPGTP
SVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDNIRPFISRCAVCEAPAMVMAV
HSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5010 nt   +upstreamnt  +downstreamnt
atggggccccggctcagcgtctggcttctgctgctgcccgccgcccttctgctccacgag
gagcacagccgggccgctgcgaagggtggctgtgctggctctggctgtggcaaatgtgac
tgccatggagtgaagggacaaaagggtgaaagaggcctcccggggttacaaggtgtcatt
gggtttcctggaatgcaaggacctgaggggccgcagggaccaccaggacaaaagggtgat
actggagaaccaggactacctggaacaaaagggacaagaggacctccgggagcatctggc
taccctggaaacccaggacttcccggaattcctggccaagacggcccgccaggcccccca
ggtattccaggatgcaatggcacaaagggagagagagggccactcgggcctcctggcttg
cctggtttcgctggaaatcccggaccaccagggttaccgggaatgaagggtgatccaggt
gagatacttggccatgtgcccgggatgctgttgaaaggtgaaagaggatttcccggaatc
ccagggaatccaggcccaccaggactgccagggcttcaaggtcctgttgggcctccagga
tttacgggaccaccaggtccccccggccctcccggccctccaggtgaaaagggacaaatg
ggcttaagttttcaaggaccgaaaggtgacaagggtgaccaaggggtcagtgggcctccg
ggagtaccaggacaagctcaagttcaagaaaaaggagacttcgccaccaagggagaaaag
ggccaaaaaggtgaacctggatttcaggggatgccaggggtcggagagaaaggtgaaccc
ggaaaaccaggacccagaggaaaacccggaaaagatggtgacaaaggggaaaaagggggt
cccggttttcctggtgaacccgggtacccaggactcataggccgccagggccctcaggga
gaaaagggtgaagcaggtcctcccggcccacctggaattgttataggcacaggacctttg
ggagaaaaaggagagaggggctaccctggaactccagggccaagaggagagccaggccca
aaaggtttcccaggactaccaggccaacccggacctccaggcctcccggtacctgggcag
gctggtgcccctggcttccctggtgaaagaggagaaaaaggtgaccgaggatttcctggt
acatctctgccaggaccaagtggaagagatgggctcccaggtcctcctggttcccccggg
ccccctgggcagcctggctacacaaatggaattgtggaatgtcagcccggacctccaggt
gaccagggtcctcctggaattccagggcagccaggattgataggcgaaattggagagaaa
ggtcaaaaaggagagagttgcctcatctgtgatatagacggatatcgggggcctcccggg
ccacagggacccccaggagaaataggtttcccaggacagccaggggccaagggcgacaga
ggtttgcctggcagagatggtgttgcgggagtgccagggcctcaaggtacaccagggctg
ataggccagccaggagccaagggggagcctggtgagatttatttcgacttgcggctcaaa
ggtgacaaaggagacccaggcttcccaggacagcccggcatgccagggagagcgggttct
cctggaagagatggccatccgggtcttcctggccccaagggctcgccgggttctgtagga
ttgaaaggagagcgtggcccccctggaggagttggattcccaggcagtcgtggtgacacc
ggcccccctgggcctccaggatatggtcctactggtcccattggtgacaaaggacaagca
ggctttcctggaggccctggatccccaggcctgccaggtccaaagggtgaaccaggaaaa
gttgttcctttaccaggcccccctggagcagaaggactgccggggtccccaggcttccca
ggtccccaaggagaccgaggctttcccggaaccccaggaaggccagggctgccaggagag
aagggtgctgtgggccagccaggaattggatttccagggccccctggccccaaaggtgtt
gatggcttacctggagacatggggcctccggggactccaggtcgcccgggatttgatggc
ttacctgggaacccaggtgtgcagggccagaagggagagcctggagttggtctgccggga
ctcaaaggtttgccaggtcttcccggcattcctggcacacccggggagaaggggagcatt
ggggtaccaggcgttcctggagaacacggagcgatcggaccccctgggcttcaggggatc
agaggtgaaccgggacctcctggattgccaggctccgtggggtctccaggagttccagga
ataggcccccctggagctaggggtccccctggaggacagggaccaccggggttgtcaggc
cctcctggaataaaaggagagaagggtttccccggattccctggactggacatgccgggc
cctaaaggagataaaggggctcaaggacttcctggcataacgggacagtcagggctccct
ggccttcctggacagcagggggctcctgggattcctgggtttccaggttccaagggagaa
atgggcgtcatggggacccctgggcagccgggctcaccaggaccagtgggtgctccggga
ttaccgggtgaaaaaggggaccatggctttccgggctcctcaggacccaggggagaccct
ggctttaaaggtgataagggggatgtcggtctccctggcaagcctggctccatggataag
gtggacatgggcagcatgaagggccagaaaggagaccaaggagagaaaggacaaattgga
ccaattggtgagaagggatcccgaggagaccctgggaccccaggagtgcctggaaaggac
gggcaggcaggacagcctgggcagccaggacctaaaggtgatccaggtataagtggaacc
ccaggtgctccaggacttccgggaccaaaaggatctgttggtggaatgggcttgccagga
acacctggagagaaaggtgtgcccggcatccctggcctgcaaggttcacctggcttacct
ggagacaaaggtgcaaaaggagagaaagggcaggcaggcccacctggcataggcatccca
gggctgcgtggtgaaaagggagatcaagggatagcgggtttcccaggaagccctggtgag
aagggagaaaaaggaagcatcgggatcccaggaatgccagggtccccaggccttaaaggg
tctcccgggagtgttggctatccaggaagccctgggctgcctggagaaaaaggtgacaaa
ggcctcccaggattggatggcatccctggtgtcaaaggagaagcaggtcttcctgggact
cctggccccacaggcccagctggccagaaaggggagccaggcagtgacggaatcccgggg
tcagcaggagagaagggtgaaccaggtctaccaggaagaggattcccagggtttccaggg
gccaaaggagacaaaggttcaaagggtgaggtgggtttcccaggattagctgggagccca
ggaattcctggatccaaaggagagcaaggattcatgggtcctccagggccccagggacag
ccggggttaccgggatccccaggccatgccacggaagggcccaaaggagaccgtggacct
cagggccagcctggcctgccaggacttccgggacctatggggcctccagggcttcctggg
attgatggagttaaaggtgacaaaggaaatccaggctggccaggagcacccggtgtccca
gggcccaagggagaccctggattccagggcatgcctggtattggtggctctccaggaatc
acaggctctaagggtgatatggggcctccaggagttccaggatttcaaggtccaaaaggt
cttcctggcctccagggaattaaaggtgatcaaggcgatcagggtgtcccgggagctaaa
ggtctcccgggtcctcctggacccccaggtccttacgacatcatcaaaggggagcccggg
ctccctggtcctgagggccccccagggctgaaagggcttcagggacttccaggcccgaaa
ggccagcaaggtgttacaggattggtgggtatacctggacctccaggtattcctgggttt
gacggtgcccctggccagaaaggagagatgggacctgctgggcctactggtccaagagga
tttccaggtccaccaggccccgatgggttgccaggatccatggggcccccaggcacccca
tctgttgatcacggcttccttgtgaccaggcacagtcaaacaatagatgacccacagtgt
ccttctgggaccaaaattctttaccatgggtactctttgctctacgtgcaaggcaatgaa
cgggcccatggccaggacctgggcacggccggcagctgcctgcgcaagttcagcacaatg
cccttcctgttctgcaatattaacaacgtgtgcaactttgcatcacgaaatgactattcg
tactggctgtccacccccgagcccatgcccatgtcaatggcacccatcacgggggacaac
ataagaccatttattagtaggtgtgctgtgtgtgaggcgcccgccatggtgatggccgtg
cacagtcagaccattcagatcccaccgtgccccagcgggtggtcctcgctgtggatcggc
tactcttttgtgatgcacaccagtgctggtgcagaaggctctggccaagccctggcgtcc
cccggctcctgtctggaggagtttagaagtgcgccattcatcgagtgtcacggccgtggg
acctgtaattactacgcaaacgcttacagcttttggctcgccaccatagagaggagcgag
atgttcaagaagcccacgccgtccaccttgaaggcaggggagctgcgcacgcacgtcagc
cgctgccaagtctgtatgagaagaacataa

KEGG   Pongo abelii (Sumatran orangutan): 100444523
Entry
100444523         CDS       T01416                                 

Gene name
COL4A2
Definition
(RefSeq) collagen alpha-2(IV) chain
  KO
K06237  collagen type IV alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04974  Protein digestion and absorption
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100444523 (COL4A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100444523 (COL4A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444523 (COL4A2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100444523 (COL4A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    100444523 (COL4A2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444523 (COL4A2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100444523 (COL4A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100444523 (COL4A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100444523 (COL4A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100444523 (COL4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100444523 (COL4A2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100444523 (COL4A2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100444523 (COL4A2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100444523 (COL4A2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100444523
NCBI-ProteinID: XP_024086739
Ensembl: ENSPPYG00000005497
LinkDB
Position
13
AA seq 1712 aa
MGRDQRAVAGPALRRWLLLGTVTVGFLAQSVLAGVKKFDVPCGGRDCSGGCQCYPEKGGR
GQPGPVGPQGYNGPPGLQGFPGLQGRKGDKGERGAPGITGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERD
RYRGEPGEPGLVGFQGPPGRPGYVGQMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKG
EKGDVGQPGPNGIPSDTLHPIIAPTRVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGF
PGPRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPGPPAYSPHPSLAKG
ARGDPGFPGAQGEPGSQGEPGDPGLPGPPGLSIGDGDQRRGLPGEMGPKGFIGDPGIPAL
YGGPPGPDGKRGPPGPPGLPGPPGPDGFLFGLKGAEGGVGFPGLPGSPGARGPKGWKGDA
GDCRCTEGDEAIRGLPGLPGPKGFAGINGEPGTKGDKGDPGQHGLPGFPGLKGVPGNVGA
PGPKGAKGDSRTITTKGERGQPGVPGVPGMKGDDGSPGRDGLDGFPGLPGPPGDGIKGPP
GDPGYPGIPGTKGTPGEMGPPGLGLPGLKGQRGFPGDAGLPGPPGFLGPPGPAGTPGQID
CDTDVKRAIGGDRQEVIQPGCIGGPKGLPGLPGPPGPTGTKGLRGIPGFSGADGGPGPKG
LPGDPGREGFPGPPGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEVLGAQ
PGPRGDAGVPGQPGLKGLPGDRGSPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGL
HGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGERGH
PGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGL
AGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLS
GIPGLPGRPGHIKGVKGDIGAPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGL
YGEIGPTGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTG
VQGPPGLKGQTGFPGLTGPPGSQGESGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHG
LPGTKGFPGSPGADIHGDPGFPGPPGERGEPGEANTLPGPVGVPGQKGDQGAPGERGPPG
SPGLQGFPGITPPSNISGVPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPG
TPGTKGWAGDAGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPG
APGTVGAPGIAGIPQKIAVQPGTVGPQGRRGHPGAPGEMGPQGPPGEPGFRGAPGKAGPQ
GRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQ
EPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASR
NDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLW
IGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIP
EQSFQGSPSADTLKAGLIRTHISRCQVCMKNL
NT seq 5139 nt   +upstreamnt  +downstreamnt
atggggagagaccagcgcgcggtggccggccctgccctacggcggtggctgctgctgggg
acagtgaccgtggggttcctcgcccagagcgtcttggcgggtgtgaagaagtttgatgtg
ccgtgcggaggaagagattgcagtgggggctgccagtgctaccctgagaaaggtggacgt
ggtcaacctgggccagtgggcccccaggggtacaacgggccaccaggattacaaggattc
ccgggactgcagggacgcaaaggagacaagggtgaacggggagcccccggaataacagga
cccaagggcgacgtgggagcaagaggcgtttctggattccctggtgctgatggaattcct
ggacacccggggcaaggtgggcccaggggaaggccgggctacgatggctgcaacggaacc
cagggagactcaggtccacaggggcctcccggctctgaggggttcaccgggcctcccggg
ccccaaggaccaaaagggcagaaaggtgagccttatgcactgcctaaagaggaacgcgac
agatatcggggtgaacctggagagcctggattggtcggtttccagggacctcccggccgc
cctgggtatgtgggacagatgggtccagttggagctccagggagaccaggaccacccgga
ccccctggaccaaaaggacagcaaggcaacagaggacttggtttctacggagttaagggt
gaaaagggtgatgtagggcagccaggacccaatgggattccatcagacaccctccacccc
atcatcgcgcccacgagagtcaccttccacccagatcagtacaagggtgaaaaaggcagt
gagggggaaccaggaataagaggcatttccttgaagggagaagaaggaatcatgggcttt
cctggaccgaggggttaccctggcttgagtggtgaaaaaggatcaccaggacagaaggga
agccgaggcctggatggctatcaaggccctgatggaccccggggacccaagggagaagcc
ggagacccagggccccctggaccacctgcctactcccctcacccttccctagcaaaaggt
gccagaggtgacccgggattcccaggggcccaaggggagccaggaagccagggtgagcca
ggagacccgggcctcccaggcccccctggcctctccatcggagatggagatcagaggaga
ggcctgccgggtgagatgggacccaagggcttcatcggagaccccggcatccctgcgctc
tacgggggcccacctggacctgatggaaagcgagggcctccaggaccccccgggctccct
ggaccacctggacctgatggcttcctgtttgggctgaaaggagcagaaggaggagtgggc
ttccctgggcttcccggctcccctggagcccgcggaccaaagggatggaaaggtgatgct
ggggactgcagatgtacagaaggtgatgaagctatcagaggtcttccgggactgccagga
cccaagggcttcgcaggcatcaacggggagccgggaacgaaaggggacaaaggagacccc
ggccaacacggcctccccgggttcccagggctcaagggagtacctggcaacgttggagct
cccggacccaaaggagcaaaaggagattccagaacaatcacgaccaaaggtgagcgggga
cagcccggcgtcccaggtgtgcccgggatgaaaggtgacgatggcagcccaggccgcgat
gggctcgatggattccccggcctcccaggccctcccggcgatggcatcaagggccctcca
ggggatccaggctatccaggaatacctggaacaaagggtactccaggagaaatgggcccc
ccaggactgggccttcccggcctcaaaggccaacgtggtttccctggagacgccggctta
cctggaccaccaggcttcctgggccctcctggccccgcagggaccccaggacaaatagat
tgtgacacagatgtgaaaagggccattggaggtgacagacaggaggtcatccagccaggt
tgcataggagggcccaagggattgccaggcctgccaggacccccaggccccacaggtacc
aaaggcctccgaggaatcccaggcttctcaggagctgatggaggaccagggcccaagggc
ttgccaggagacccaggtcgtgaagggttcccaggacccccagggttcataggaccccga
ggatccaaaggtgcagtgggcctccctggcccagatggatccccaggtcccatcggcctg
ccagggccagacgggccccctggggaaaggggccttcctggagaagtcctgggagcccag
cccgggccacggggagatgctggtgtgcctggacagcctgggcttaaaggccttcctgga
gacagaggctcccctggattcagaggaagccaagggatgcctgggatgccagggctgaag
gggcagccaggcctcccaggaccttccggccagccaggcctatacgggcctccaggactg
catggattcccaggagctcctggccaagaggggcccttggggctgccaggaatcccaggc
cgtgaaggtctgcctggtgatagaggggaccctggggacacaggcgctcctggccctgtg
ggaatgaaaggtctctctggtgacagaggagatgctggcttcacaggggagcgaggccat
ccaggaagccctggatttaaaggaattgatggaatgcctgggacccccgggctaaaagga
gatagaggctcacctgggatggatggtttccaaggcatgcctggactcaaagggagaccc
gggtttccagggagcaaaggcgaggctggatttttcggaatacccggtctgaagggtctg
gctggtgagccaggttttaaaggcagccgaggggaccctgggcccccaggaccacctcct
gtcatcctgccaggaatgaaagacattaaaggagagaaaggagacgaagggcctatgggg
ctgaaaggatacctgggcgcaaaaggtatccaaggaatgccaggcatcccggggctgtcg
ggaatccctgggctgcctgggaggcccggccacatcaaaggagtcaagggagacatcgga
gcccccggcatccccggtttgccaggattccctggggtggctggcccccctggaattaca
ggattcccaggattcataggaagccggggtgacaaaggtgccccagggagagcaggcctg
tatggcgagatcggcccgactggtgatttcggtgacatcggggacactataaatttacca
ggaagaccaggcctgaagggggagcggggcaccactggaataccaggtctgaagggattc
tttggagagaagggaacagaaggtgacatcggcttccctgggataacaggcgtgactgga
gtccaaggccctcctggacttaaaggacaaacaggctttccagggctgactgggcctcca
gggtcgcagggagagtcggggcggattggactgcctggtggcaaaggagatgatggttgg
ccgggagctccgggcttaccaggttttccgggactccgtgggatccgcggcttacacggc
ttgccaggcaccaaaggctttccaggatccccaggtgctgacatccacggagacccaggc
ttcccaggccctcctggggaaagaggtgaaccaggagaggccaacacccttccaggccct
gtgggagtcccaggacagaaaggagaccaaggagctccaggggaacgaggcccacctggg
agtccaggacttcaggggttccctggcatcacgcccccttccaacatctctggggtacct
ggtgacaaaggggcgccagggatatttggcctgaaaggttatcggggcccaccagggcca
ccagggtctgctgctcttcctggaagcaaaggtgacacagggaacccaggagctccagga
accccagggaccaaaggatgggccggggacgccgggccccagggcaggcctggtgtgttc
ggtctcccgggagaaaaagggcccaggggtgaacaaggcttcatggggaacactggaccc
accggggcggtgggcgacagaggccccaagggacccaagggagacccaggattccctggt
gcccccgggactgtgggagcccccgggattgcaggaatcccccagaagattgccgtccaa
ccagggacagtgggtccccaggggaggcgaggccaccctggggcaccgggggagatgggg
ccccagggcccccccggagaaccaggtttccgtggggctccagggaaagctgggccccaa
ggaagaggtggtgtgtctgctgttcccgggttccggggagatgaaggacccataggccac
caggggccgattggccaagaaggtgcaccaggccgtccagggagcccaggcctgccgggt
atgccaggccgcagcgtcagcatcggctacctcctggtgaagcacagccagacggaccag
gagcccatgtgcccggtgggcatgaacaagctctggagtgggtacagcctgctgtacttc
gagggccaggagaaggcgcacaaccaggacctggggctggcgggctcctgcctggcgcgg
ttcagcaccatgcccttcctgtactgcaaccctggtgatgtctgctactatgccagccgg
aacgacaagtcctactggctctctaccactgccccgctgcccatgatgcctgtggccgag
gacgagatcaagccctacatcagccgctgctctgtgtgtgaggccccagccgtcgccatc
gcggtccacagtcaggatgtctccattccacactgcccagctgggtggcggagtttgtgg
atcggatattccttcctcatgcacacggcggcgggagacgaaggcggtggccagtcactg
gtgtcaccaggcagctgtctggaggacttccgtgccacaccattcatcgagtgcaatgga
ggccgcggcacctgccactactacgccaacaagtacagcttctggctgaccaccattccc
gagcagagcttccagggctcgccctctgccgacacgctcaaggccggcctcatccgcaca
cacatcagccgctgccaggtgtgcatgaagaacctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100446634
Entry
100446634         CDS       T01416                                 

Gene name
LAMC2
Definition
(RefSeq) laminin subunit gamma-2
  KO
K06246  laminin, gamma 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100446634 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100446634 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100446634 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100446634 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100446634 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100446634 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100446634 (LAMC2)
   05145 Toxoplasmosis
    100446634 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 100446634
NCBI-ProteinID: XP_024099499
Ensembl: ENSPPYG00000000429
LinkDB
Position
1
AA seq 1219 aa
MLVTLRVSLEHLQDGLPRYLRKFILHGTPGFGRRHMPRQSRPLLALTGTGGMVCDCNGKS
RQCIFDQELHRQTGNGFRCLNCNDNTDGIHCERCKDGFYRHRERDRCLPCNCNSKGSLSA
RCDNSGWCSCKPGVTGARCDRCLPGFHMLTDAGCTQDQRLLDSKCDCDPAGIAGPCDAGR
CVCKPAVTGERCDRCRSGYYNLDGGNPEGCTQCFCYGHSASCRSSADYSVHKITSTFHQD
VDGWKAVQRNGSPAKLQWSQRHQDVFSSAQRLDPVYFVAPAKFLGNQQVSYGQSLSFDYR
VDRGGRHPSAHDVILEGAGLRITAPLMPIGKTLPCGLTKTYTFRLNEHPSSNWSPQLSYF
EYRRLLRNLTALRIRATYGEYSTGYIDNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQ
DCASGYKRDSARLGPFGTCIPCNCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPH
DPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPC
QPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCQACN
CNPMGSEPVECRSDGTCVCKPGFGGPNCEHGAFSCPACYNQVKIQMDQFMQQLQRMEALI
SKAQGGDGAVPDKELEGRMQQAEQALQDILRDAQISEGASRSLGLQLAKVRSQENSYRSR
LDDLKMTVERIRALGSQYQNRVRDTHRLITQMQLSLAESEASLRNTNIPASDHYVGPNGF
KSLAQEATRLAESHVESASNVEQLTRETEDYSKQALSLVRKALHEGVGSGSGSPNGAVVQ
GLVEKLEKTKSLAQQLTREATQAEIEADRSYQHSLRLLDSVSQLQGVNDQSFQVEEAKKI
KQKADSLSSLVTRHMDEFKRTQKNLGNWKEETQQLLQNGKSGREKSDQLLSRANLAKSRA
QEALSMGNATFYEVESILKNLREFDLQVDNRKAEAEEAMKRLSYISQKVSDASDKTQQAE
RALGSAAADAQRAKNGAREALEISSEIEQEIGSLNLEANVTADGALAMEKGLASLKSEMR
EVEGELERKELEFDTNMDAVQMVITEAQRVDTRAKNAGVTIQDTLNTLDGLLHLMDQPVS
VDEEGLILLEQKLSRAKTQINSQLRPMMSELEERARRQRGHLHLLETSIDGILADVKNLE
NIRDNLPPGCYNTQALEQQ
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgttagtcactttgcgagtctctttggaacatctgcaggatgggcttcctagatacttg
agaaagttcattcttcatgggacacctggctttgggaggagacacatgcccagacagtca
cgtccgctcctcgccttgacgggcaccggtgggatggtctgtgattgcaatggaaagtcc
aggcagtgtatctttgatcaggaacttcacagacaaactggtaatggattccgctgcctc
aactgcaatgacaacactgatggcattcactgcgagaggtgcaaggacggcttttaccgg
cacagagaaagggaccgctgtttgccctgcaattgtaactccaaaggttctcttagtgct
cgatgtgacaactccggatggtgcagctgtaaaccaggtgtgacaggagccagatgcgac
cgatgtctgccaggcttccacatgctcacagatgcggggtgcacccaagaccagagactg
ctagactccaagtgtgactgtgacccagctggcatcgcagggccctgtgacgcgggccgc
tgtgtctgcaagccagctgtcactggagaacgctgtgataggtgtcgatcaggttactat
aatctggatggggggaaccctgagggctgtacccagtgtttctgctacggacattcagcc
agctgccgcagctctgcagactacagtgtccataagatcacctctacctttcatcaagat
gttgatggctggaaggctgtccaacgaaatgggtctcctgcaaagctccaatggtcgcag
cgccatcaagatgtgtttagctcagcccaacgactagaccctgtctattttgtggctcct
gccaaatttcttgggaatcaacaggtgagctatgggcaaagcctgtcctttgactaccgt
gtggacagaggaggcagacacccatctgcccatgatgtgatcctggaaggtgctggtcta
cggatcacagctcccttgatgccaattggcaagacactgccttgtgggctcaccaagact
tacacattcaggttaaatgagcatccaagcagtaattggagcccccagctgagttacttt
gagtatcgaaggttactgcggaatctcacagccctccgcatccgagctacatatggagaa
tacagtactgggtacattgacaatgtgaccctgatttcagcccgccctgtctctggagcc
ccagcaccctgggttgaacagtgtatatgtcctgttgggtacaaggggcaattctgccag
gattgtgcttctggctacaagagagattcagcgagactggggccttttggcacctgtatt
ccttgtaactgtcaagggggaggggcctgtgatccagacacaggagattgttattcaggg
gatgagaatcctgacattgagtgtgctgactgcccaattggtttctacaacgatccgcac
gacccccgcagctgcaagccatgtccctgtcataacgggttcagctgctcagtgatgcca
gagacagaggaggtggtgtgcaataactgccctcccggggtcaccggtgcccgctgtgag
ctctgtgctgatggctactttggggacccctttggtgaacatggcccagtgaggccttgt
cagccctgtcaatgcaacaacaatgtggaccccagtgcctctgggaactgtgaccggctg
acaggcaggtgtttgaagtgtatccacaacacagccggcatctactgcgaccagtgcaaa
gcaggctacttcggggacccgttggctcccaacccagcagacaagtgtcaagcttgcaac
tgtaaccccatgggctcagagcctgtagaatgtcgaagtgatggcacctgtgtttgcaag
ccaggatttggtggccccaactgtgagcatggagcattcagctgtccagcttgctataat
caagtgaaaattcagatggatcagtttatgcagcagcttcagagaatggaggccctgatt
tcaaaggctcagggtggtgatggagcagtacctgataaagagctggaaggcaggatgcag
caggctgagcaggcccttcaggacattctgagagatgcccagatttcagaaggtgctagc
agatcccttggtctccagttggccaaggtgaggagccaagagaacagctaccggagccgc
ctggatgacctcaagatgactgtggaaagaattcgggctctgggaagtcagtaccagaac
cgagttcgggatactcacaggctcatcactcagatgcagctgagcctggcagaaagtgaa
gcttccttgagaaacactaacattcctgcctcagaccactacgtggggccaaatggcttt
aaaagtctggctcaggaggccacgagattagcagaaagccacgttgagtcggccagtaac
gtggagcaactgacaagggaaactgaggactattccaaacaagccctctcactggtgcgc
aaggccttgcatgaaggagttggaagcggaagcggtagcccgaacggtgctgtggtgcaa
gggcttgtggaaaaattggagaaaaccaagtccctggcccagcagttgacaagggaggcc
actcaagcggaaattgaagcagataggtcttatcagcacagtctccgcctcctggattca
gtgtctcagcttcagggagtcaatgatcagtcctttcaggtggaagaagcaaagaagatc
aaacaaaaagctgattcactctcaagcctggtaaccaggcatatggatgagttcaagcgt
acacaaaagaatctgggaaactggaaagaagaaacacagcagctcttacagaatggaaaa
agtgggagagagaaatcagatcagctgctttcccgtgccaatcttgctaaaagcagagca
caagaagcactgagtatgggcaatgccactttttatgaagttgagagcatccttaaaaac
ctcagagagtttgacctgcaggtggacaacagaaaagcagaagctgaagaagccatgaag
agactctcctacatcagccagaaggtttcagacgccagtgacaagacccagcaagcagaa
agagccctggggagcgctgctgctgacgcgcagagggcaaagaatggggccagggaggcc
ctggaaatctccagtgagattgaacaggagattgggagtctgaacttggaagccaatgtg
acagcagatggagccttggccatggaaaagggactggcctctctgaagagtgagatgagg
gaagtggaaggagagctggaaaggaaggagctggagtttgacacgaatatggatgcagta
cagatggtgattacagaagcccagagggttgataccagagccaagaacgctggggttaca
atccaagacacactcaacacattggatggcctcctgcatctgatggaccagcctgtcagt
gtagatgaagaggggctgatcttattggagcagaagctttcccgagccaagacccagatc
aacagccaactgcggcccatgatgtcagagctggaagagagggcacgtcggcagaggggt
cacctccatttgctggagacaagcatagatgggattctggctgatgtgaagaacttggag
aacattagggacaacctgcccccaggctgctacaatacccaggctcttgagcaacagtga

KEGG   Pongo abelii (Sumatran orangutan): 100446999
Entry
100446999         CDS       T01416                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05020  Prion disease
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100446999 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100446999 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100446999 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100446999 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100446999 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    100446999 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100446999 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100446999 (LAMC1)
   05145 Toxoplasmosis
    100446999 (LAMC1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B PurA
Other DBs
NCBI-GeneID: 100446999
NCBI-ProteinID: XP_009238479
LinkDB
Position
1
AA seq 1608 aa
MRGSHRAAPAVRPRGRLWPVLAVLAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRST
GHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNVETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRVEQRDGSEASLEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQLLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEAADYPWRPALTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSPC
VLCACNGHSETCDPETGVCNCRDNTAGLHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSC
AVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNPYGTVKQQSSCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGIT
GQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDECEENYFY
NRSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAERE
VMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVENT
ERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQVKNISQDLEKQAARVHEEAKRAG
DKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEHLIDQKLKDYEDLKEDMRGKELEV
KNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDNK
TAAEEALRKIPAINQTIIEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNAT
STKAEAERTFAEVTDLDNEVNSMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEI
NARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDL
ENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
NT seq 4827 nt   +upstreamnt  +downstreamnt
atgagggggagccatcgggccgcgccggccgtgcgaccccgggggcggctctggcccgtg
ctggccgtgctggcggccgccgcggcgggctgtgcccaggcagccatggacgagtgcacg
gacgagggcgggcggccgcagcgctgcatgcccgagttcgtcaacgccgccttcaacgtg
actgtggtggccaccaacacgtgtgggactccgcccgaggaatactgtgtgcagaccggg
gtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcagcac
ggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccag
accatgctggccggggtgcagtaccccagctccatcaacctcacgctgcacctgggaaaa
gcttttgacatcacctatgtgcgtctcaagttccacaccagccgcccagagagctttgcc
atttacaagcgcacaagggaagatgggccctggattccttaccagtactacagtggttcc
tgcgagaacacctactccaaggcaaaccgcggcttcatcaggacaggaggggacgagcag
caggccttgtgtactgatgaattcagtgacatttctcccctcactgggggcaatgtggcc
ttttctaccctggaaggaaggcccagcgcctataactttgacaatagccctgtgctgcag
gaatgggtaactgccactgacatcagagtaactcttaatcgcctgaacacttttggagat
gaagtgtttaacgatcccaaagttctcaagtcctattattatgcgatctctgattttgct
gtgggtggcagatgtaaatgtaatggacatgcaagcgagtgtatgaagaacgaatttgat
aagctggtgtgtaattgcaaacataacacatatggagtagactgtgaaaagtgtcttcct
ttcttcaatgaccggccgtggaggagggcaactgcagaaagtgccagtgaatgcctgccc
tgtgactgcaatggtcgatcccaggaatgctacttcgatcctgaactctatcgttccact
ggccatgggggccactgtaccaactgccaggataacacagatggcgcccactgtgagagg
tgccgggagaacttcttccgccttggaaacaatgaagcctgctctccatgccactgtagt
cctgtgggctctctaagcacacagtgtgatagttatggcagatgcagctgtaagccagga
gtgatgggggacaaatgtgaccgttgccagcctggattccattctctcactgaagcagga
tgcaggccatgctcttgtgatccctctggcagcatagatgaatgtaatgttgaaacagga
agatgtgtttgcaaagacaatgtcgaaggcttcaattgtgaaagatgcaaacctggattt
tttaatctggaatcatctaatcctcggggttgcacaccctgcttctgctttgggcattct
tctgtctgtacaaatgctgttggctacagtgtttattctatctcctctacctttcagatt
gatgaggatgggtggcgtgtggaacagagagatggctctgaagcatctctcgagtggtcc
tctgagaggcaagatatcgctgtgatctcagacagctactttcctcggtacttcattgct
cctgcaaagttcttgggcaagcagttgttgagttatggtcagaacctctccttctccttt
cgagtggacaggcgcgatactcgcctctctgcagaagaccttgtgcttgagggagctggc
ttaagagtatcggtacccttgatcgctcagggcaattcctatccaagtgagaccactgtg
aagtatgtcttcaggctccatgaagcagcagattacccttggaggcctgctcttacccct
tttgaatttcagaagctcctaaacaacttgacctctatcaagatccgtgggacatacagt
gagagaagtgctggatatttggatgatgtcaccctggcaagtgctcgtcctgggcctgga
gttcctgcaacttgggtggagtcctgcacctgtcctgtgggatatggagggcagttttgt
gagatgtgtctctcaggttacagaagagaaactcctaatcttggaccatacagtccatgt
gtgctttgcgcctgcaatggacacagcgagacctgtgatcctgagacaggtgtttgtaac
tgcagagacaatacagctggcctgcactgtgagaagtgcagtgatgggtactatggagat
tcaactgcaggcacctcctccgattgccaaccctgtccgtgtcctggaggttcaagttgt
gctgttgtccccaagacaaaggaggtggtgtgcaccaactgtcctactggcaccactggt
aagagatgtgagctctgtgatgatggctactttggagaccccctgggtagaaacggccct
gtgagactttgccgtctgtgccagtgcaatgacaacatcgatcccaacgcagttggaaat
tgcaatcgcttgacaggagaatgcctgaagtgcatctataacactgctggcttctattgt
gaccggtgcaaagacggattttttggaaatcctctggctcccaatccagcagacaaatgc
aaagcctgcaattgcaatccatatgggacagtgaagcagcagagcagctgtaaccccgtg
acggggcaatgtgaatgtttgcctcacgtgactggccgggactgtggtgcctgtgaccct
ggattctacaatctgcagagtgggcaaggctgtgaaaggtgtgactgccatgccttgggc
tccaccaatgggcagtgtgacatccgcaccggccagtgtgagtgccagcccggcatcacc
ggtcagcactgtgagcgctgtgaggtcaaccactttgggtttggacctgaaggctgcaaa
ccctgtgactgtcatcccgagggatctctttcacttcagtgcaaagatgatggtcgctgt
gaatgcagagaaggctttgtgggaaatcgctgtgacgagtgtgaagaaaactatttctac
aatcggtcttggcctggctgccaggaatgtccagcttgttaccggctggtaaaggataag
gttgctgatcatagagtgaagctccaggaattagagagtcttatagcaaaccttggaact
ggggatgagatggtgacagatcaagccttcgaggatagactaaaggaagcagagagggaa
gttatggacctccttcgtgaggcccaggatgtcaaagatgttgaccagaatttgatggat
cgcctacagagagtgaataacactctgtccagccaaattagccgtttacagaatatccgg
aataccattgaagagactggaaacttggctgaacaagcacgtgcccatgtagagaacaca
gagcggttgattgaaatcgcatccagagaacttgagaaagcaaaagtcgctgctgccaat
gtgtcagtcactcagccagaatctaccggggacccaaacaacatgactcttttggcagaa
gaggctcgaaagcttgctgaacgtcataaacaggaagctgatgacattgttcgagtggca
aagacagccaatgatacatcaactgaggcatacaacctgcttttgaggacactggcagga
gaaaatcaaacagcatttgagattgaagagcttaataggaagtatgaacaagtgaagaac
atctcacaggatctggaaaaacaagctgcccgagtacatgaggaggccaaaagggctggt
gacaaagctgtggagatctatgccagcgtggctcagctgagccctttggactctgagaca
ctggagaatgaagcaaataacataaagatggaagctgagaatctggaacatctgattgat
cagaaattaaaagattatgaggacctcaaagaagatatgagagggaaggaacttgaagtc
aagaaccttctggagaaaggcaagactgaacagcagaccgcagaccaactcctagcccga
gctgatgctgccaaggccctcgctgaagaagctgcaaagaagggacgggataccttacaa
gaagctaatgacattctcaacaacctgaaagattttgataggcgcgtgaacgataacaag
acggccgcagaggaggcgctaaggaagattcctgccatcaaccagaccatcattgaagct
aatgaaaagaccagggaagcccagcaggccctgggcaatgctgcagcggatgccacagag
gccaaaaacaaggcccatgaggcggagaggatcgcgagcgctgtccaaaagaatgccacc
agcaccaaggcagaagctgaaagaacttttgcagaagttacagatctggataatgaggtg
aacagtatgttgaagcaactacaggaagcagaaaaagagctaaagagaaaacaagatgac
gctgaccaggacatgatgatggcagggatggcttcacaggctgctcaagaagccgagatc
aatgccagaaaagccaaaaactctgttactagcctcctcagcattattaatgacctcttg
gagcagctggggcagctggatacagtggacctaaataagctaaacgagattgaaggcacc
ctaaacaaagccaaagatgaaatgaaggtcagcgatcttgataggaaagtgtctgacctg
gagaatgaagccaagaagcaggaggctgccatcatggactacaaccgagatatcgaggag
atcatgaaggacattcgcaatctggaggacatcaggaagaccttaccatctggctgcttc
aacaccccgtccattgaaaagccctag

KEGG   Pongo abelii (Sumatran orangutan): 100449704
Entry
100449704         CDS       T01416                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04810  Regulation of actin cytoskeleton
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100449704 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100449704 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100449704 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100449704 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449704 (FN1)
   05205 Proteoglycans in cancer
    100449704 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100449704 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100449704 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100449704 (FN1)
   05100 Bacterial invasion of epithelial cells
    100449704 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100449704 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100449704 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100449704 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100449704 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100449704 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100449704 (FN1)
Membrane trafficking [BR:pon04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    100449704 (FN1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100449704 (FN1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100449704 (FN1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   100449704 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369
Other DBs
NCBI-GeneID: 100449704
NCBI-ProteinID: XP_009236347
Ensembl: ENSPPYG00000013148
LinkDB
Position
2B
AA seq 2477 aa
MLRGPGPGLLLLAVLCLGTAVPSTAASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPFSP
VVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVNHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATG
IFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHLSGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPSNGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSSPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPI
ECFMPLDVQADREDSRE
NT seq 7434 nt   +upstreamnt  +downstreamnt
atgctcaggggtccggggcccgggctgctgctgctggccgtcctgtgcctggggacagcg
gtgccctccactgcagcctcgaagagcaagaggcaggctcagcaaatggttcagccccag
tccccggtggctgtcagtcaaagcaagcccggttgttatgacaatggaaaacactatcag
ataaatcaacagtgggagcggacctacctgggcaatgccttggtttgtacttgttatgga
ggaagccgaggttttaactgcgagagtaaacctgaagctgaagagacttgctttgacaag
tacactgggaacacttaccgagtgggtgacacttatgagcgtcctaaagactccatgatc
tgggactgtacctgcatcggggctgggcgagggagaataagctgtaccattgcaaaccgc
tgccatgaagggggtcagtcctacaagattggggacacctggaggagaccacatgagact
ggtggttacatgttagagtgtgtgtgtcttggtaatggaaaaggagaatggacctgcaag
cccatagctgagaagtgttttgatcatgctgctgggacttcctatgtggttggagaaacc
tgggaaaagccctaccaaggctggatgatggtggattgtacttgtttgggagaaggcagc
ggacgcatcacttgcacctctagaaatagatgcaacgatcaggacacaaggacatcctat
agaattggagacacctggagcaagaaggataatcgaggaaacctgctccagtgcatctgc
acaggcaacggccgaggagagtggaagtgtgaaaggcacacctctgtgcagaccacatca
agcggatctggccccttcactgatgttcgtgcagctgtttaccaaccgcagcctcacccc
cagcctcctccctatggtcactgtgtcacagacagtggtgtggtctactctgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcatgtgcctgggcaacggagtc
agctgccaagagacagctgtaacccagacttatggtggcaactcaaatggagagccatgt
gtcttaccattcacctacaatggcaggacgttctactcctgcaccacagaagggcgacag
gatggacatctttggtgcagcacaacttcgaattatgagcaggaccagaaatattctttc
tgcacagaccacactgttttggttcagactcgaggaggaaattccaatggtgccttgtgt
cacttccccttcctatacaacaaccacaattacactgattgcacttctgagggcagaaga
gacaacatgaagtggtgtgggaccacacagaactatgatgccgaccagaagtttgggttc
tgccccatggctgcccatgaggaaatctgcacaaccaatgaaggggtcatgtaccgcatt
ggagatcagtgggataagcagcatgacatgggtcacatgatgaggtgcacgtgtgttggg
aacggtcgtggggaatggacatgcattgcctactcgcagcttcgagatcagtgcattgtt
gatgacatcacttacaatgtgaatgacacattccacaagcgtcatgaagaggggcacatg
ctgaactgtacatgcttcggtcagggtcggggaagatggaagtgtgatcccgtcgaccaa
tgccaggattcagagactgggacgttttatcaaattggagattcatgggagaagtatgtg
catggtgtcagataccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttacagacctatccaagctcaagtggtcctgtcgaagtatttatcactgaaactccg
agtcagcccaactcccaccccatccagtggaatgcaccacagccatctcacatttccaag
tacattctcaggtggagacctaaaaattctgtaggccgttggaaggaagctaccatacca
ggccacttaaactcctacaccatcaaaggcctgaagcctggtgtggtatacgagggccag
ctcatcagcatccagcagtacggccaccgagaagtgactcgctttgacttcaccaccacc
agcaccagcacacctgtgaccagcaacaccgtgacaggagagacaactcccttttctccc
gttgtggccacttctgaatctgtgaccgaaatcacagccagcagctttgtggtctcctgg
gtctcagcttctgacaccgtgtcgggattccgggtggaatatgagctgagtgaggaggga
gatgagccacagtacctggatcttccaagcacagccacttccgtgaacatccctgacctg
cttcctggccgaaaatacattgtaaatgtctatcagatatctgaggatggggagcagagt
ttgatcctgtctacttcacaaacaacagcgcccgatgcccctcctgacccgactgtggac
caagttgatgacacctcaattgttgttcgctggagcagaccccaggctcccatcacaggg
tacagaatagtctattcaccatcagtagaaggtagcagcacagaactcaaccttcctgaa
actgcaaactccgtcaccctcagtgatttgcaacctggtgttcagtataacatcactatc
tatgctgtggaagaaaatcaagaaagtacacctgttgtcattcaacaagaaaccactggc
accccacgctcagatacagtgccctctcccagggacctgcagtttgtggaagtgacagat
gtgaaggtcaccatcatgtggacaccgcctgagagtgcagtgaccggctaccgcgtggat
gtcatccctgtcaacctgcctggcgagcacgggcagaggctgcccatcagcaggaacacc
tttgcagaagtcaccgggctgtcccctggggtcacctattacttcaaagtctttgcagtg
aaccacgggagggagagcaagcctctgactgctcaacagacaaccaaactggatgctccc
actaacctccagtttgtcaatgaaactgattctactgtcctggtgagatggactccacct
cgggcccagataacaggataccgactgaccgtgggcctgacccgaagaggccagcccagg
cagtacaatgtgggtccctctgtctccaagtacccactgaggaatctgcagcctggatct
gagtacaccgtatccctcgtggccataaagggcaaccaagagagccccaaagccactgga
atctttaccacactgcagcctgggagctctattccaccttacaacaccgaggtgactgag
accaccattgtgatcacatggacgcctgctccaagaattggttttaagctgggtgtacga
ccaagccagggaggagaggcaccaagagaagtgacttcagactcagggagcatcgttgtg
tctggcttgactccaggagtggaatacgtctacaccatccaagtcctgagagacggacag
gaaagagatgcgccaattgtaaacaaagtggtaacaccattgtctccaccaacaaacttg
catctggaggcaaaccctgacactggagtgctcacagtctcctgggagaggagcaccacc
ccagacattactggttatagaattaccacaacccctacaaacggccagcagggatattct
ttggaagaagtggtccatgctgatcagagctcctgcacttttgataacctgagtcccggc
ctggagtacaatgtcagtgtttacactgtcaaggatgacaaggaaagtgtccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagtcacagggctggagccgggcattgactatgatatcagcgttatcact
ctcattaatggcggcgagagtgcccctactacactgacacaacaaacggctgttcctcct
cccactgacctgcgattcaccaacattggtccagacaccatgcgtgtcacctgggctcca
cccccatccattgatttgaccaacttcctggtgcgttactcacctgtgaaaaatgaggaa
gatgttgcagagttgtcaatttctccttcagacaatgcagtggtcttaacaaatctcctg
cctggtacagaatatgtagtgagtgtctccagtgtctatgaacaacacgagagcacacct
cttagaggaagacagaaaacaggtcttgattccccaactggtattgacttttctgatatt
accgccaactcttttactgtgcactggattgctcctcgagccaccatcactggttacagg
atccgccatcatcccgagcaccttagtgggagacctcgagaagatcgggtgcccccctct
cggaattccatcaccctcaccaacctcactccgggcacagagtatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcccttattgattggccaacaatcaacagtttctgat
gttccaagggacctggaagttgttgctgcgacccccaccagcctactgatcagctgggat
gctcctgctgtcacagtgagatattacaggatcacttatggagaaacaggaggaaatagc
cctgtccaggagttcactgtgcctgggagcaagtctacagctaccatcagtggccttaaa
cctggagttgattataccatcactgtgtatgctgtcactggccgtggagacagccccgcg
agcagcaagccaatttccattaattaccgaacagaaattgacaaaccatcccagatgcaa
gtgaccgatgttcaggacaacagcattagtgtcaagtggctgccttcaagttcccctgtt
actggttacagagtaaccaccactcccaaaaatggaccaggaccaacaaaaactaaaact
gcaggtccagatcaaacagaaatgactattgaaggcttgcagcccacagtggagtatgtg
gttagtgtctatgctcagaatccaagcggagagagtcagcctctggttcagactgcagta
accaacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacactgcagagctg
caaggcctcagaccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagctattcctgcaccaactgacctgaag
ttcactcaagtcacacccacgagcctgagcgcccagtggacaccacccaatgttcagctc
actggatatagagtgcgggtgacccccaaggagaagaccggaccaatgaaagaaatcaac
cttgctcctgacagctcatccgtggttgtatcaggacttatggtggccaccaaatatgaa
gtgagtgtctatgctcttaaggacactttgacaagcagaccagctcagggagttgtcacc
actctggagaatgtcagcccaccaagaagggctcgtgtgacagatgctactgagaccacc
atcaccattagctggagaaccaagaccgagacgatcactggcttccaagttgatgctgtt
ccatccaatggccagactcctatccagagaaccatcaagccagatgtcagaagctacacc
atcacaggtttacaaccaggcactgactacaagatctacctgtacaccttgaacgacaat
gcccggagctcccctgtggtcatcgacgcctccactgccattgatgcgccatccaacctg
cgtttcctggccaccacacccaattccttgctggtatcatggcagccgccacgtgccagg
attaccggctacatcatcaagtatgagaagcctgggtcttctcccagagaagtggtccct
cggccccgccctggtgtcacagaggctactattactggcctggaaccgggaaccgaatat
acaatttatgtcattgccctgaagaataatcagaagagcgagcccctgattggaaggaaa
aagacagacgagcttccccaactggtaacccttccacaccccaatcttcatggaccagag
atcttggatgttccttccacagttcaaaagacccctttcgtcacccaccctgggtatgac
actggaaatggtattcagcttcctggcacttctggtcagcaacccagtgttgggcaacaa
atgatctttgaggaacatggttttaggcggaccacaccgcccacaacggccacccccata
aggcataggccaagaccatacccgccgaatgtaggtgaggagatccaaattggtcacatc
cccagggaagatgtagactatcacctctacccacatggtccgggactcaatccaaatgcc
tctacaggacaagaagctctctctcagacaaccatctcatgggccccattccaggacact
tctgagtacatcatttcatgtcatcctgttggcaccgatgaagaacccttacagttcagg
gttcctggaacttctaccagtgccactctgacaggcctcaccagaggtgccacctacaac
atcatagtggaggcactgaaagaccagcagaggcataaggttcgggaagaggttgttacc
gtgggcaactctgtcaacgaaggcttgaaccaacctacggatgactcgtgctttgacccc
tacacagtttcccattatgccgttggagatgagtgggaacgaatgtctgaatcaggcttt
aaactgttgtgccagtgcttaggctttggaagtggtcatttcagatgtgattcatctaga
tggtgccatgacaatggtgtgaactacaagattggagagaagtgggaccgtcagggagaa
aatggccagatgatgagctgcacgtgtcttgggaacggaaaaggagaattcaagtgtgac
cctcatgaggcaacgtgttatgatgatgggaagacgtaccacgtaggagaacagtggcag
aaggaatatctcggtgccatttgctcctgcacatgctttggaggccagcggggctggcgc
tgtgacaactgccgcagacctggcggtgaacccagtcccgaaggcactactggccagtcc
tacaaccagtattctcagagataccatcagagaacaaacactaatgttaattgcccaatt
gaatgcttcatgcctttagatgtacaggctgacagagaagattcccgagagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100456580
Entry
100456580         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-5-like
  KO
K06240  laminin, alpha 3/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100456580
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100456580
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100456580
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100456580
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100456580
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100456580
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100456580
   05145 Toxoplasmosis
    100456580
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B Laminin_I
Other DBs
NCBI-GeneID: 100456580
NCBI-ProteinID: XP_024097300
LinkDB
Position
20
AA seq 2289 aa
MAKRLCXGSALCVRGPRGPAPLLLVGLALLGAARAREEAGGGFSLHPPYFNLAEGARIAA
SATCGEEAPARGSPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAHPASNA
IDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGR
TYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENGEIVVSLVNGRPG
AMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
VCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCN
CHGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPNHPL
DSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSND
TREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCVCKPNFQGTHCELCAPGFYGPGCQP
CQCSSPGVADNRCDPDTGQCRCRAGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCD
EAGRCLCQPEFAGPHCDQCRPGYHGFPNCQACTCDPRGALDQLCGAGGLCRCRPGYTGTA
CQECSPGFHGFPSCVPCHCSAEGSLHAACDSQSGQCSCRPRVTGLRCDTCVPGAYNFPYC
EAGSCHPAGLASVDPALPEAQVPCMCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDP
RGTLGGVAQCQPGTGQCFCKPHVCGQACASCKDGFFGLDQADYFGCRSCQCDIGGALGQS
CEPRTGACRCRPNTQGPTCSKPARDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFEN
FSWRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSAACANC
TAQSQPVAFPPSTEPAFITVPQRGFGEPFVLNPGTWALLVEAEGVLLDYVVLLPSAYYEA
ALLQLRVTEACTYRPSAQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQL
SPSHPPLITCTGSDVDVQLQVAVPQPGRYALVVEYANEDARQEVGMAVHTPQRAPQQGLL
SLHPCLYSTLCRGTARDTHDRLAVFHLDSEASVRLTAEQARFFLHGVTLVPIEEFSPEFL
EPRVRCISSHGAFGPGSAACLPSRFPKPPQPLILRDCQVIPLPPGLPLTHAQDLTPATSP
TGPQPRPPTAVDPDAEPTLLREPQATVVFTTHVPMLGRYAFLLHGYQPAHPTFPVEVLIN
AGRVWQGHANASFCPHGYGCRTLVVCEGQALLDVTHSELTVTVRVPEGRWLWLDYVLVVP
ENVYSFGYLREEPLDKSYDFISHCAAQGYHISPSSSSLFCRNAAASLSLFYNNGARPCGC
HEVGATGPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTGQCIC
PPRTVPPDCLLCQPQTFGCHPLVGCEECNCSGPGVQELTDPTCDTDSGQCKCRPNVTGRR
CDTCSPGFHGYPRCRPCDCHEAGTAPGVCDPLTGQCYCKENVQGPRCDQCSLGTFSLDAA
NPKGCTRCFCFGATERCRSSSYTRQEFVDMEGWVLLSTDRQVVPHERRPGTEMLRADLRH
VPEAVPEAFPELYWQAPPSYLGDRVSSYGGTLRYELHSETQRGDVFVPMESRPDVALQGN
QMSITFLEPAYPTPGHVHRGQLQLVEGNFRHTETRNTVSREELMMVLASLEQLQIRALFS
QISSAVSLRRVALEVASPAGQGALASNVELCLCPASYRGDSCQECAPGFYRDVKGLFLGR
CVPCQCHGHSDRCLPGSGICVDCQHNTEGAHCERCQAGFVSSGEDPSAPCVSCPCPLSVP
SNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNLL
FSDCDPLTGACRGCLRHTTGPRCEICAPGFYGNALLPGNCTRCNCAPCGTEACDPHSGHC
LCKAGVTGQRCDHCQEGHFGFDGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTMGPQCR
ECAPGYWGLPEQGCRRCQCPGGRCDPHTGHCTCPPGLSGERCDTCSQQHQVPVPGGTVGH
SIHCEVCDHCVVLLLDDLERAGALLPAIREQLRGINASSVAWARLHRLNASIADLQSQLR
SPLGPRHETAQQLEVLEQQSTSLGQDARRLGGQAGAPRPPRALGGFHLCSPRFGSLVLIQ
QMLLHASYM
NT seq 6870 nt   +upstreamnt  +downstreamnt
atggcgaagcggctctgcngcgggagcgcactgtgtgttcgcggcccccggggccccgca
ccgctgctgctggtcggactggcgctgctgggcgcggcgcgggcgcgggaggaggcgggc
ggcggcttcagcctgcacccgccctacttcaacctggccgagggcgcccgcatcgccgcc
tccgcgacctgcggagaggaggccccggcgcgcggctccccgcgccccaccgaagacctt
tactgcaagctggtggggggccccgtggccggcggcgaccccaaccagaccatccagggc
cagtactgcgacatctgcacggctgcgaacagcaacaaggcacaccccgcgagcaatgcc
atcgacggcacggagcgctggtggcagagcccaccgctgtcccgcggcctggagtacaac
gaggtcaatgtcaccctggacctgggccaggtcttccatgtggcctacgtcctcatcaag
tttgccaactcaccccggccggacctctgggtgctggagcggtccatggacttcggccgc
acctaccagccctggcagttctttgcctcctcaaagagggactgtctggagcggttcggg
ccacagacgctggagcgcatcacacgggacgacgcggccatctgcaccaccgagtactca
cgcatcgtgcccctggagaacggagagatcgtggtgtccctggtgaacggacgtccgggc
gccatgaatttctcctactcgccgctgctacgtgagttcaccaaggccaccaacgtccgc
ctgcgcttcctgcgcaccaacacgctgctggggcacctcatggggaaggcgctgcgggac
cccacggtcacccgccggtattattacagcatcaaggatatcagcattggaggccgctgt
gtctgccatggccacgcagatgcctgtgatgccaaagaccccacggacccgttcaggctg
cagtgcacctgccagcacaacacctgtgggggcacctgcgaccgctgctgccccggcttc
aaccagcagccgtggaagcctgcgactgccaacagtgccaacgagtgccagtcctgtaac
tgccacggccatgccaccgactgttactacgaccctgaggtggaccggcgccgcgccagc
cagagcctggatggcacctatcagggtgggggtgtctgtatcgactgccagcaccacacc
actggcgtcaactgtgagcgctgcctgcccggcttctaccgctctcccaaccacccactc
gactcgccccacgtctgccgccgctgcaactgcgagtccgacttcacagatggcacctgc
gaggacctgacgggtcgctgctactgccggcccaacttctctggggagcggtgtgacgtg
tgtgccgagggcttcacaggcttcccaagctgctacccgacgccctcgtcgtccaatgac
accagggagcaggtgctgccagctggccagattgtgaattgtgactgcagcgcggcaggg
acccagggcaacgcctgccggaaggacccgagggtgggacgctgtgtgtgcaaacccaac
ttccaaggcacccattgtgagctctgcgcgccagggttctacggccccggctgccagccc
tgccagtgttccagccctggagtggccgacaaccgctgtgaccctgacacaggccagtgc
aggtgccgagcgggcttcgagggggccacgtgtgatcgctgtgcccccggctactttcac
ttccctctctgccagttgtgtggctgcagccctgcaggaaccctgcccgagggctgcgat
gaggccggccgctgcctgtgccagcctgagtttgccggacctcattgtgaccagtgccgc
cctggctaccacggtttccctaactgccaagcatgcacctgtgaccctcggggagccctg
gaccagctctgtggggcgggaggtttgtgccgctgccgccccggctacacaggcaccgcc
tgccaggaatgcagccccggcttccacggctttcccagctgtgtcccctgccactgctct
gccgaaggctccctgcacgcagcctgtgactcccagagtgggcagtgcagctgtcggccc
cgcgtgacggggctgcggtgtgacacgtgtgtgcccggtgcctacaacttcccctactgc
gaagctggctcttgccaccctgctggtctggcctcagtggatcctgcccttcctgaggca
caggttccctgtatgtgccgggctcacgtggaggggccgagctgcgaccgctgcaaacct
gggttctggggactgagccccagcaaccccgagggctgtacccgctgcagctgcgacccc
aggggcacgctgggtggagttgctcagtgccagccgggcaccggccagtgcttctgcaag
ccccacgtgtgtggccaggcctgcgcatcctgcaaggatggtttctttggactggatcag
gctgactatttcggctgccgcagctgccagtgtgacattggcggtgcgctgggccagagc
tgtgaaccgaggacgggcgcctgccggtgccgccccaacacccaaggccccacctgcagc
aagcctgcgagggaccactacctcccagacctgcaccacctgcgcctggaactggaggag
gccgccacacctgagggtcacgccgtgcgctttggcttcaaccccctcgagttcgagaac
ttcagctggaggggctatgcgcagatggcacctgtccagcccaggatcgtggccaggctg
aacctgacctcccccgaccttttctggcttgtcttccgatacgtcaaccggggggccatg
agtgtgagcgggcgggtctctgtgcgagaggagggcaggtcggctgcctgcgccaactgc
acagcgcagagccagcctgtggccttcccacccagcacggaacctgccttcatcactgtg
ccccagaggggcttcggagagccctttgtactgaatcctggcacctgggccctgcttgtg
gaggctgaaggggtgctcctggactacgtggttctgctgcctagcgcatactacgaggcg
gcgctcctgcagctgcgggtgaccgaggcctgcacataccgcccctctgcccagcagtct
ggcgacaactgcctcctctacacacacctccccctggatggcttcccctcggccgccggg
ctggaggccctgtgtcgccaggacaacagcctgccccggccctgccccacggaacagctc
agcccatcgcacccgccactgatcacctgcacgggcagtgatgtggacgtccagcttcaa
gtggcagtgccgcagccgggccgctacgccctagtggtggagtacgccaatgaggatgcc
cgccaggaggtgggcatggccgtgcacaccccacagcgggccccccagcaggggctgctc
tccctgcacccctgcctgtacagcaccctgtgccggggcaccgcccgggatacccatgac
cgcctggctgtcttccacctggactcagaggccagcgtgaggctcacagctgagcaggca
cgcttcttcctgcatggggtcactctggtgcccattgaggagttcagcccggagttcttg
gagccccgggtccgctgcatcagcagccacggcgcctttggccccggcagtgctgcctgt
ctgccctcgcgcttcccaaagccgccccagcccctcatcctcagggactgccaggtgatc
ccactgccgcccggcctcccgctgacccacgcacaggatctcactccagccacgtcccca
accggaccccaacctcggccccccaccgccgtggaccctgacgcggagcccaccctgctg
cgtgagccccaggccaccgtggtcttcaccacccatgtgcccatgttgggccgctacgcc
ttcctgctgcacggctaccagccagcccaccccaccttccccgtggaagtcctcatcaac
gccggccgcgtgtggcagggccacgccaacgccagcttctgtccacatggctatggctgc
cgcaccctggtggtgtgtgagggccaggccctgctggacgtgacccacagcgagctcact
gtgaccgtgcgtgtgcccgagggccggtggctctggctggattatgtactcgtggtccct
gagaacgtctacagctttggctacctccgggaggagcccctggacaaatcctatgacttc
atcagccactgcgcagcccagggctaccacatcagccccagcagctcatccctgttctgc
cgaaacgctgctgcttccctctccctcttctataacaacggagcccgtccatgtggctgc
cacgaagtaggtgctacaggccccacgtgtgagcccttcgggggccagtgtccctgccgt
gcccacgtcattggtcgtgactgctcccgctgtgccaccggatactggggcttccccaat
tgcaggccctgtgactgcggcgcccgcctctgtgacgagctcacgggccagtgcatctgc
ccaccacgcaccgtcccgcccgactgcctgctgtgccagccccagacctttggctgccac
cccctggtcggctgtgaggagtgtaactgctcagggcccggcgtccaggagctcacagac
cctacctgtgacacagacagcggccagtgcaagtgcagacccaacgtgactgggcgccgc
tgtgatacctgctctccgggcttccatggctacccccgctgccgcccctgtgactgtcac
gaggcgggcactgcgcctggcgtgtgtgatcccctcacagggcagtgctactgtaaggag
aacgtgcagggccccagatgtgaccagtgcagccttgggaccttctccctggatgctgcc
aaccccaaaggttgcacccgctgcttctgctttggggccacggagcgctgccggagctcg
tcctacacccgccaggagttcgtggacatggagggctgggtgctgctgagcactgaccgg
caggtggtgccccacgagcggcggccagggacggagatgctccgtgcagacctgcggcat
gtgcctgaggctgtgcccgaggctttccccgagctgtactggcaggccccgccctcctac
ctgggggaccgggtgtcatcctacggtgggaccctccgttatgaactgcactcagagacc
cagcggggagatgtcttcgtccccatggagagcaggccggatgtggcgctgcagggcaac
cagatgagcatcacattcctggagccggcgtaccccacgcctggccacgttcaccgtggg
cagctgcaactggtggaggggaacttccggcacacggagactcgcaacactgtgtcccgc
gaggagctcatgatggtgctggccagcctggagcagctgcagatccgtgccctcttctca
cagatctcctcggctgtctccctgcgcagggtggcactggaggtggccagcccagcaggc
cagggggccctggccagcaatgtggagctgtgcctgtgccccgccagctaccggggggac
tcatgccaggaatgtgcccccggcttctatcgggacgtcaaaggtctcttcctgggccga
tgtgtcccttgtcagtgccatggacactcagaccgctgcctccctggctctggcatctgt
gtggactgccagcacaacaccgaaggggcccactgtgagcgctgccaggctggcttcgtg
agcagcggggaggaccccagcgccccctgtgtcagctgcccctgtcccctctccgtgcct
tccaacaacttcgccgagggctgtgtcctgcgaggcggccgcacccagtgcctctgcaaa
cctggttatgcaggtgcctcctgtgagcggtgtgcgcccggattcttcgggaacccactg
gtgctgggcagctcctgccagccttgcgactgcagcggcaacggtgaccctaacttgctc
ttcagcgactgcgaccccctgacgggtgcctgccgtggctgcctgcgccacaccaccggg
cctcgctgcgaaatctgtgcccccggcttctacggcaatgccctgctgcccggcaactgc
acccgatgcaactgtgccccatgtgggacagaggcctgcgacccccacagcgggcactgc
ctgtgcaaggcaggtgtgactgggcagcgctgtgaccattgtcaggagggacattttggt
ttcgacggctgcgggggctgccgcccgtgtgcttgtggaccggccgccgagggctccgag
tgccacccccagagcggacagtgccactgccgaccagggaccatgggaccccagtgccgc
gagtgtgcccctggctactggggactccctgagcagggctgcaggcgctgccagtgccct
gggggccgctgtgaccctcacacgggccactgcacctgccccccggggctcagcggggag
cgctgcgacacctgcagccagcagcatcaggtgcccgttcccggcgggactgtgggccac
agcatccactgtgaagtgtgtgaccactgtgtggtcctgcttctggatgacctggaacgg
gccggcgccctcctccccgccattcgtgagcaactgcgtggcatcaatgccagctccgtg
gcctgggcccgtctgcacaggctgaatgcctccatcgctgacctgcagagccagcttcgg
agccccctgggcccccgccatgagacagcacagcagctggaggtgctggagcagcagagc
acaagcctcgggcaggatgcacggcggctgggcggccaggcaggagccccaagacccccc
agggccctgggaggctttcacctgtgttccccgcggttcggttcgcttgtcctcattcag
cagatgttacttcatgcctcatatatgtga

KEGG   Pongo abelii (Sumatran orangutan): 100457450
Entry
100457450         CDS       T01416                                 

Gene name
COL4A6
Definition
(RefSeq) collagen alpha-6(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04974  Protein digestion and absorption
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100457450 (COL4A6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100457450 (COL4A6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100457450 (COL4A6)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100457450 (COL4A6)
  09154 Digestive system
   04974 Protein digestion and absorption
    100457450 (COL4A6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457450 (COL4A6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100457450 (COL4A6)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100457450 (COL4A6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100457450 (COL4A6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100457450 (COL4A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100457450 (COL4A6)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100457450 (COL4A6)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100457450 (COL4A6)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100457450 (COL4A6)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100457450
NCBI-ProteinID: XP_009233428
Ensembl: ENSPPYG00000020620
LinkDB
Position
X
AA seq 1690 aa
MHPGLWLLLVTLCLTEELAGAGEKSYGKPCGGQDCRRSCQCFPEKGARGRPGPIGIQGPT
GPQGFTGSTGLSGLKGERGSPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPP
GLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDG
ITGPQGALGSPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGP
PPSTGELEFMGFPKGQKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGP
RGPMGSEGVHGPPGQQGKKGTLGFPGLNGFQGMEGQKGDIGLPGPDVFIDIDGAVISGNP
GDPGVPGLPGLKGDEGIQGLRGPSGAPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIG
AAGLPGRDGLPGPPGPPGPPSPEFETETLHNKEPGFPGLRGEQGPKGNPGLKGIKGDSGF
CACDGGVPNTGPPGEPGPPGPRGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP
KGKKGEPILSTIQGMPGDRGDSGSQGFHGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEK
GLPGLPGEKGHPGPPGLPGIGLPGLPGPPGLPGDKGNDGLPGQQGLPGSKGITLPCIIPG
SYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGTKGEPGSPGLVHLPELPGFPGPRGEKG
LPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAESGAPGEQGLQGLTGDKGFLGDSGL
PGLKGVHGKPGLLGPKGEQGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGH
PGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGSKGEKGS
VGFVGFPGIPGLPGIPGTRGLKGIPGSAGKMGPSGHAGTPGEKGDRGNPGPVGIPSPRRP
MSNLWLKGDKGSQGSAGSGGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPG
FMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSP
GPKGQPGESGLKGTKGRDGLIGNIGFPGNKGEDGKIGVSGDVGLPGAPGFPGVAGMRGEP
GLQGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAG
LPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDP
GRPGLDGERGRPGPPGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGEL
GLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGPQGAPGQTPTAEAVQVPPGP
LGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGP
PGFEGAPGQQGPFGMPGMPGQSVRVGYTLVKHSQSEQVPLCPIGMSQLWVGYSLLFVEGQ
EKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQI
PQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSP
GSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRV
SRCQVCMKSL
NT seq 5073 nt   +upstreamnt  +downstreamnt
atgcaccctgggttgtggctgctcctggttacgttgtgcctgaccgaggaactggcagga
gcgggagagaagtcttatggaaagccatgtgggggccaagactgcagacggagctgtcag
tgttttcctgagaaaggagcgagagggcgacctggaccaattggaattcaaggcccaaca
ggtcctcaaggattcactggctctactggtttatcaggattgaaaggagaaaggggttcc
ccaggccttctcggaccttatggaccaaaaggagataagggtcccatgggagttcctggc
tttcttggcatcaatgggattccgggccatcctggacagccaggccccagaggcccacct
ggtctggatggctgtaatggaactcaaggagctgttggatttccaggccctgatggctat
cctgggcttctcggaccacccgggcttcctggtcagaaaggatcaaaaggtgaccctgtc
cttgctccaggtagtttcaaaggaatgaagggggatcctgggctgcctggactggatgga
atcactggcccacaaggagcactcggatctcctggagctgtaggacctgcaggaccacca
ggattacaaggtcctccagggcctcctggtcctcttggtcctgatgggaatatggggcta
ggttttcaaggagagaaaggagtcaagggggatgttggcctccctggcccagcaggacct
ccaccatctactggagagctggaattcatgggattccccaaagggcagaaaggatccaag
ggtgaaccagggcctaagggttttccaggcataagtggccctccaggcttcccgggcctt
ggaactactggagaaaagggagaaaagggagaaaagggaatccctggtttgccaggacct
aggggtcccatgggttcagaaggagtccatggccctccagggcaacagggcaagaaaggg
accctgggatttcctgggcttaatggattccaaggaatggagggtcaaaagggtgacatt
ggcctgccaggcccagatgttttcatcgatatagatggtgctgtgatctcaggtaatcct
ggagatcctggtgtacctggcctcccaggccttaaaggagatgaaggcatccaaggccta
cgtggcccttctggtgcccctggcttgccagcattatcaggtgtcccaggagccctaggg
cctcagggatttccagggctgaagggggaccaaggaaacccaggccgtaccacaattgga
gcagctggcctccctggcagagatggtttgccaggcccaccaggtccaccaggcccacct
agtccagaatttgagaccgaaactctacacaacaaagagccagggttccctggtctccga
ggagaacaaggtccaaaaggaaacccaggcctcaaaggaataaaaggagactcaggtttc
tgtgcttgtgacggtggtgttcccaacactggaccacccggggaaccaggcccacctggt
ccacggggtctcataggccttccaggccttaaaggagccagaggagatcgaggctctggg
ggtgcacagggcccagcaggggctccaggcttagttgggcctctgggtccttcaggaccc
aaaggaaagaagggggaaccaattctcagtacaattcaaggaatgccaggggatcggggt
gattctggctcccagggcttccatggtgtaataggagaaccaggcaaggacggagtacca
ggtttaccaggtctgccaggccttccgggtgatggtggacagggcttcccaggtgaaaag
gggttacctggacttcctggtgaaaaaggccatcctggtccacctggcctcccaggaatt
gggttaccaggacttcctggaccccctgggcttcctggagataaaggcaatgatggatta
ccaggacaacaaggccttcccggatctaagggaatcactctgccttgtattattcccggg
tcatatggtccatcaggatttccaggcactcccggattcccaggccctaaagggtcccga
ggcctccctgggaccccaggccagcctgggtcaagcggaactaaaggagagccagggagt
ccaggattggttcatcttcctgaattaccaggatttcctggacctcgtggggagaagggc
ttgcctgggtttcctgggctccctggaaaagatggcttgcctgggatgattggcagtcca
ggcttacctggttccaagggagccactggtgacatctttggtgctgaaagtggtgctccg
ggggaacaaggcctacaaggattaacaggggacaaaggatttcttggagactctggcctt
ccgggactcaagggtgtgcacgggaagcctggcttactaggccccaaaggtgagcagggc
agccctgggacaccaggacaggtgggacagccaggcaccccaggatctagtggtccatat
ggcatcaagggcaaatctgggctcccaggagcaccgggcttcccaggcatctcaggacat
cctggaaagaaaggaacaagaggcaagaaaggtcctcctggatcaattgtaaagaaaggg
ctgccagggttaaaaggccttcctggaaatccaggcctagtaggactgaaaggaagccca
ggctctccaggggtcgctgggttgccagccctctctggatccaagggagagaaggggtct
gttggattcgtaggttttccaggaataccaggtctgcctggtattcctgggacaagagga
ttaaagggaattccgggatcagctggaaaaatgggaccatctggacacgctggtactcct
ggtgaaaagggagacagaggcaatccggggccagtcggaatacctagtccaagacgtcca
atgtcaaacctttggctcaaaggagacaaaggctctcaaggctcagccggatccggtgga
tttcctgggccaagaggtgacaaaggagaggctggtcgacctgggccaccaggcctgcct
ggagctcctggcctcccaggcattatcaaaggagttagtggaaagccagggccccctggc
ttcatgggaatccggggcttacctggcctgaaggggtcctctgggatcacaggtttccca
ggaatgccaggagaaagtggttcacaaggtatcagagggtcgcctggactcccaggagca
tctggtctcccaggcctgaaaggagacaacggccagacagttgaaatttccggtagccca
ggacccaagggacagcctggtgaatctggtcttaaaggtacaaaaggaagagatggacta
ataggcaatataggcttccctggaaacaaaggtgaagatggaaaaattggtgtttccgga
gatgttggccttcctggagctccaggatttccaggagttgccggcatgagaggagaacca
ggacttcaaggttcttctggtcatcaaggggcaattgggcccctaggatcccccggatta
ataggacccaaaggcttccctggatttcctggtttacatggactgaatgggcttccgggc
accaagggtacccatggcactccaggacctagtatcaccggtgtgcccgggcctgctggt
ctccctggacccaaaggagaaaaaggatatccaggaattggcatcggagctccagggaag
ccgggcctgagagggcaaaaaggtgatcgaggtttcccaggtctccagggccctgctggt
ctccccggtgccccaggcatctccttgccttcactcatagcaggacagcctggtgacccc
gggcgaccaggcctagatggagaacgaggccgcccaggcccccctggacccccaggtccc
cctgggccatcctcgaatcaaggcgacaccggagaccctggcttccctggaattcctgga
cctaaagggcctaagggagaccaaggaattccaggtttttctggcctccctggagagcta
ggactgaaaggcatgagaggtgagcctggcttcatggggactccaggcaaggttgggcca
cctggagacccaggatttcccggaatgaaggggaaggcagggccaagaggctcttctggc
ccccaaggtgctcctggacaaacaccaactgcagaagctgtccaggttcctcctggaccc
ttgggtctaccagggatcgatggcatccctggcctcactggggaccctggggctcaaggc
cctgtaggcctacaaggctccaaaggtttacctggcatccccggtaaagatggccccagt
gggctcccgggcccacctggggctcttggtgatcctggtctgcctggactgcaaggccct
ccaggatttgaaggagctccaggacagcaaggccccttcgggatgcctggaatgcctggc
cagagcgtgagagtgggctacacgttggtaaagcacagccagtcggaacaggtgcccctg
tgtcccatcgggatgagccagctgtgggtggggtacagcttactgtttgtggagggacaa
gagaaagcccacaaccaggacctgggctttgctggctcctgtctgccccgcttcagcacc
atgccgttcatctactgcaacatcaacgaggtgtgccactatgccaggcgcaatgataaa
tcttactggctctccactaccgcccctatccccatgatgcccgtcagccagacccagatt
ccccagtacatcagccgctgctctgtgtgtgaggcaccctcgcaagccattgctgtgcac
agccaggacatcaccatcccacagtgccccctgggctggcgcagcctctggattgggtac
tccttcctcatgcacactgccgctggtgctgagggtggaggccagtccctggtctcacct
ggctcctgcctagaggactttcgggccactcctttcatcgagtgcagtggcgcccgaggc
acctgccactactttgcaaacaagtacagtttctggttgaccacagtggaggagaggcag
cagtttggggagttgcctgtgtctgaaacgctgaaagctgggcagctccacactcgagtc
agtcgctgccaggtgtgtatgaaaagcctgtag

KEGG   Pongo abelii (Sumatran orangutan): 100457807
Entry
100457807         CDS       T01416                                 

Gene name
COL4A5
Definition
(RefSeq) collagen alpha-5(IV) chain isoform X3
  KO
K06237  collagen type IV alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04974  Protein digestion and absorption
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100457807 (COL4A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100457807 (COL4A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100457807 (COL4A5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100457807 (COL4A5)
  09154 Digestive system
   04974 Protein digestion and absorption
    100457807 (COL4A5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457807 (COL4A5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100457807 (COL4A5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100457807 (COL4A5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100457807 (COL4A5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100457807 (COL4A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100457807 (COL4A5)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100457807 (COL4A5)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100457807 (COL4A5)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100457807 (COL4A5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100457807
NCBI-ProteinID: XP_002832026
Ensembl: ENSPPYG00000020622
LinkDB
Position
X
AA seq 1685 aa
MKLRGVSLAAGLFLLALSLWGQPAEAAACYGCSPGSKCDCSGIKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPG
IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKP
GKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDTGPPGPPGLVIPRPGTGITIGEKGN
IGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPG
PPGLDGQPGAPGLPGPPGPPGPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGF
PGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGITFKG
ERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTIT
QPGKPGLPGNPGRDGEVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGI
PGPPGAPGTPGRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGTLGPKGDRGFP
GPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHG
IPGERGDPGPPGLDVPGPPGERGSPGIPGAPGPIGPPGSPGLPGKAGASGFPGTKGEMGM
MGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPAGEKGSKGEPGLPGPPGPMDPNLL
GSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLT
GPPGLKGAIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPG
PKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPG
NPGLPGEPGPVGGGGRPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGL
SGQKGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPP
GRPGLPGPEGSPGLPGNGAIKGEKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGLNGMK
GDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGPPGLPGPSGQSIIIKGDSGPPGI
PGQPGLKGLPGLQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGP
PGPDGLQGPPGPPGTSSIAHGFLITRHSQSTDAPQCPQGTLQVYEGFSLLYVQGNKRAHG
QDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPF
ISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSC
LEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISRCQV
CMKRT
NT seq 5058 nt   +upstreamnt  +downstreamnt
atgaaactgcgtggagtcagcctggctgccggcttgttcttactggccctgagtctttgg
gggcagcctgcagaggctgcggcttgctatgggtgttctccaggatcaaagtgtgactgc
agtggcataaaaggggaaaagggagagagagggtttccaggtttggaaggacatccagga
ttgcctggatttccaggtccagaagggcctccagggcctcggggacaaaagggtgatgat
ggaattccagggccaccaggaccaaaaggaatcagaggtcctcctgggcttcctggattt
ccagggacaccaggtcttcctggaatgccaggccatgatggggccccaggacctcaaggt
attcccggatgcaatggaaccaagggagaacgtggatttccaggcagtcccggttttcct
ggtttacagggtcctccaggaccccctggtatcccaggtatgaagggtgaaccaggtagt
ataattatgtcatcactgccaggaccaaagggtaatccaggatatccaggtcctcctgga
atacaaggcctacctggtcccactggtataccagggccaattggtcccccaggaccacca
ggtttgatgggccctcctggtccaccaggacttccaggacctaaggggaatatgggctta
aatttccagggacccaaaggtgaaaaaggtgagcaaggtcttcagggcccacctgggcca
cctgggcagatcagtgaacagaaaagaccaattgatgtagagtttcagaaaggagatcag
ggacttcctggtgaccgagggcctcctggacctccagggatacgtggtcctccaggtccc
ccaggtggtgagaaaggtgagaagggtgagcaaggagagccaggcaaaagaggtaaacca
ggcaaagatggagaaaatggccaaccaggaattcctggtttgcctggtgatcctggttac
cctggtgaacctggaagggatggtgaaaagggccaaaaaggtgacactggcccacctgga
cctcctggacttgtaattcctagacctgggactggtataactataggagaaaagggaaac
attgggttgcctggcttgcctggagaaaaaggagagcgaggatttcctggaatacagggt
ccacctggccttcctggacctccaggggctgcagttatgggtcctcctggccctcctgga
tttcctggagaaaggggtcagaaaggtgatgaaggaccacctggaatttccattcctgga
cctcctggacttgatggacagcctggggctcctgggcttccagggcctcctggccctcct
ggccctcacatccctcctagtgatgagatatgtgaaccaggccctccaggccccccagga
tctccaggtgataaaggactccaaggagaacaaggagtgaaaggtgacaaaggtgacact
tgcttcaactgcattggaactggtatttcagggcctccaggtcaacctggtttgccaggt
ctcccaggtcctccaggatctcttggtttccctggacagaaaggtgaaaaaggacaagct
ggtgcaactggtcccaaaggattacccggcattccaggagctccaggtgctccaggcttt
cctggatctaaaggtgaacctggtgatatcctcacttttccaggaatgaagggtgacaaa
ggagagttgggttcccctggagctccagggcttcctggtttacctggtactcctggacag
gatggattgccagggcttcctggcccgaaaggagagcctggtggaattacttttaagggt
gaaagaggtccccctgggaacccaggtttaccaggcctcccagggaatatagggcctatg
ggtccccctggtttcggccctccaggcccagtaggtgaaaaaggcatacaaggtgtggca
ggaaatccaggccagccaggaataccaggtcctaaaggggatccaggtcagactataacc
cagccagggaagcctggcttgcctggtaacccaggcagagatggtgaagtaggtcttcca
ggtgaccctggactcccagggcaaccaggcttgccagggatacctggtagcaaaggagaa
ccaggtatccctggaattgggcttcctggaccacctggtcccaaaggctttcctggaatt
ccaggacctccaggagcacctgggacacctggaagaattggtctagaaggccctcctggg
ccacccggctttccaggaccaaagggtgaaccaggatttgcattacctgggccacctggg
ccaccaggacttccaggtttcaaaggaacacttggtccaaaaggtgatcgtggtttccca
ggacctccaggtcctccaggacgcactggcttagatgggctccctggaccaaaaggtgat
gttggaccaaatggacaacctggaccaatgggacctcctgggctgccaggaataggtgtt
cagggaccaccaggaccaccagggattcctgggccaataggtcaacctggtttacatgga
ataccaggagagaggggggatccaggacctcctggacttgatgttccaggtcccccaggt
gaaagaggcagtccagggatccccggagcacctggtcctataggacctccaggatcacca
gggcttccaggaaaagcaggtgcctctggatttccaggtaccaaaggtgaaatgggtatg
atgggacctccaggcccaccaggacctttgggaattcctggcaggagtggtgtacctggt
cttaaaggtgatgatggcttgcagggtcagccaggacttcctggccctgcaggagaaaaa
ggtagtaaaggagagcctggccttccaggccctcctggaccaatggatccaaatcttctg
ggctcaaaaggagagaagggggaacctggcttaccaggtatacctggagtttcagggccg
aaaggttatcagggtttgcctggagacccagggcaacctggactgagtggacaacctgga
ttaccaggaccaccaggtcccaaaggtaaccctggtctccctggacagccaggtcttaca
ggacctcctggacttaaaggagccatcggtgatatgggttttccagggcctcagggtgtg
gaagggcctcctggaccttctggagttcctggacaacctggctccccaggattacctgga
cagaaaggcgacaaaggtgatcctggtatttcaagcattggtcttccaggtcttcctggt
ccaaagggtgagcctggtctgcctggatacccagggaaccctggtatcaaaggttctgtg
ggagatcctggtttgcccggattaccaggaacccctggagcaaaaggacaaccaggcctt
cctggattcccaggaaccccaggccctcctggaccaaaaggtattagtggccctcctggg
aaccctggccttccaggagaacctggtcctgtaggtggtgggggtcgtcctgggcaacca
gggcctccaggcgaaaaaggcaaacctggtcaagatggtattcctggaccagctggacag
aagggtgaaccaggtcaaccaggctttggaaacccaggaccccctggacttccaggactt
tctggccaaaagggtgatggaggattacctgggattccaggaaatcctggccttccaggt
ccaaagggcgaaccaggctttcacggtttccctggtgtgcagggtcccccgggccctcct
ggttctccgggtccagctctggaaggacctaaaggcaaccctgggccccaaggtcctcct
gggagaccaggtctaccaggtccagaaggttctccgggtctccctggaaatggagctatt
aaaggagagaagggaaatccaggccaacctgggctacctggcttgcctggtttgaaagga
gatcaaggaccaccaggactccagggtaatcctggccggccaggtctcaatggaatgaaa
ggagatcctggtctccctggtgttccaggattcccaggcatgaaaggacccagtggagta
cctggatcagctggccctgagggggaaccgggacttattggtcctccaggtcctcctgga
ttacctggtccttcaggacagagtatcataatcaaaggagattctggtcctccaggaatc
cctggccagcctgggttaaaaggtctaccaggactccaaggacctcaaggtttaccaggt
ccaactggccctccaggagatcctggacgcaatggactccctggctttgatggtgcagga
gggcgcaaaggagacccaggtctgccaggacagccaggtacccgtggtttggatggtccc
cccgggccagatggattgcaaggtcccccaggtccccctggaacctcctctattgcacat
ggatttcttattacacgccacagccagtcaacggatgcaccacaatgcccgcagggaaca
cttcaggtctatgaaggcttttctctcctgtatgtacaaggaaataaaagagcccacggt
caagacttggggacggctggcagctgccttcgtcgctttagtaccatgcctttcatgttc
tgcaacatcaataatgtttgcaactttgcttcaagaaatgactattcttactggctctct
accccagagcccatgccaatgagcatgcaacccctaaagggccagagcatccagccattc
attagtcgatgtgcagtatgtgaagctccagctgtggtgatcgcagttcacagtcagacg
atccagattccccattgtcctcagggatgggattctctgtggattggttattccttcatg
atgcatacaagtgcaggggcagaaggctcaggtcaagccctagcctcccctggttcctgc
ttggaagagtttcgttcagctcccttcatcgaatgtcatgggaggggtacctgtaactac
tatgccaactcctacagcttttggctggcaactgtagatgtgtcagacatgttcagtaaa
cctcagtcagaaacgctgaaagcaggagacttgaggacacgaattagccgatgtcaagtg
tgcatgaagaggacataa

KEGG   Pongo abelii (Sumatran orangutan): 100458670
Entry
100458670         CDS       T01416                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta-1
  KO
K05636  laminin, beta 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100458670 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100458670 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100458670 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458670 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100458670 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100458670 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100458670 (LAMB1)
   05145 Toxoplasmosis
    100458670 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C
Other DBs
NCBI-GeneID: 100458670
NCBI-ProteinID: XP_009241417
Ensembl: ENSPPYG00000017907
UniProt: H2PN73
LinkDB
Position
7
AA seq 1786 aa
MGLLQVLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGTSTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGLNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVYLATGNISGG
VCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGTCDSYTDFSTG
LIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQC
NEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPG
SRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGG
SGDVVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISAVLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQC
HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GYFGNPSEVGGSCQPCQCHNNIDATDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDA
LRQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTG
CDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDV
TEMMAQVEVKLSDTTSQSNGTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGEKKCGGPGCGGLVTVAHNA
WQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEEL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEII
LQQSAADIARAEMLLEEAKKASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSADDVKKTLHGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KDLERKYEGNQKYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atgggacttctccaggtgttagctttcagtttcttagccctgtgccgagcccgagtgcgc
gctcaggaacccgagttcagctacggctgcgctgaaggcagctgctatcccgccacgggc
gaccttctcatcggccgagcacagaagctttcggtgacctcgacgtgcgggctgcacaag
cccgaaccctactgtatcgtcagccacttgcaggaggacaaaaaatgcttcatatgcaat
tcccaagatccttatcatgagaccctgaatcctgacagccatctcattgaaaatgtggtc
actacatttgctccaaaccgccttaagatttggtggcaatctgaaaatggtgtggaaaat
gtaactatccaactggatttggaagcagaattccattttactcatctcataatgactttc
aagacattccgtccagctgctatgctgatagaacgatcgtccgactttgggaaaacctgg
ggtgtgtatagatacttcgcctatgactgtgaggcctcgtttccaggcacttcaactggc
cccatgaaaaaagtcgatgacataatttgtgattcccgatattctgacattgaaccctca
actgaaggagaggtgatatttcgtgctttagatcctgctttcaaaatagaagatccttat
agcccaaggatacagaatttattaaaaattaccaacttgagaatcaagtttgtgaaactg
catactttgggagataaccttctggattccagaatggaaatcagagaaaagtattattat
gcagtttatgatatggtggttcgaggaaattgcttctgctatggtcatgccagcgaatgt
gcccctgtggatggactcaatgaagaagtggaaggaatggttcacggacactgcatgtgc
aggcataacaccaaaggcttaaactgtgaactctgcatggatttctaccatgatttacct
tggagacctgctgaaggccgaaacagcaacgcctgtaaaaaatgtaactgcaatgaacat
tccagctcatgtcactttgacatggctgtttacctggccacggggaacatcagcggaggc
gtgtgtgatgactgtcagcacaacaccatggggcgcaactgtgagcagtgcaagccgttt
tactaccagcacccagagagggacatccgagatcctaatttctgtgaacgatgtacatgt
gacccagctggctctcaaaatgagggaacttgtgacagctatactgatttttctactggt
ctcattgctggccagtgtcggtgtaaattaaatgtggaaggagaacattgtgatgtttgc
aaagaaggcttctatgatttaagcagtgaagatccatttggttgtaaatcttgtgcttgc
aatcctctgggaacgattcctggagggaatccttgtgattctgagacaggtcattgctac
tgcaagcgtctggtgacaggacagcattgtgaccagtgtctgccagagcactggggctta
agcaatgatttggatggatgtcgaccatgtgactgtgaccttgggggagcgttaaacaac
agttgctttgcagagtcaggccagtgctcatgtcggcctcacatgattgggcgtcagtgc
aacgaagtggaacctggttactactttgccaccctggatcactacctctatgaagcagag
gaagccaacttggggcctggggttagcatagtggagcggcaatatatccaggaccggatt
ccctcctggactggagccggcttcgtccgagtgcctgaaggggcttatttggagtttttc
attgacaacataccatattccatggagtatgacatcctaattcgctacgagccacagcta
cccgaccactgggaaaaagctgtcatcacagtgcagcgacctggaaggattccaaccagc
agccgatgtggtaataccatcccagatgacgacaaccaggtggtgtcattatcaccaggc
tcaagatatgtcgtccttcctcggccagtgtgctttgagaagggaacaaactacacggtg
aggttggagctacctcagtacacctcctctgatagcgacgtggagagcccatacacgctg
atcgattctcttgttctcatgccatactgtaaatcactggacatcttcaccgtgggaggt
tcaggagatgtggtggtcaccaacagcgcctgggaaacctttcagagataccgatgtcta
gagaacagcagaagcgttgtgaaaacgccgatgacagatgtttgcagaaacatcatcttt
agcatttctgctgtgttacaccagacaggcctggcttgtgaatgcgaccctcagggttcg
ttaagttccgtgtgtgatcccaacggaggccagtgccagtgccggcccaacgtggttgga
agaacctgcaacagatgtgcacctggaacttttggctttggccccagtggatgcaaacct
tgtgagtgccatctgcaaggatctgtcaatgccttctgcaatcccgtcactggccagtgc
cactgtttccagggagtgtatgctcggcagtgtgatcggtgcttacctgggcactggggc
tttccaagttgccagccctgccagtgcaatggccacgccgatgactgcgacccagtgacg
ggggagtgcttgaactgccaggactataccatgggtcataactgtgaaaggtgcttggct
ggttactatggtgaccccatcattgggtcaggagatcactgccgcccttgcccttgccca
gatggtcctgacagtggacgccagtttgccaggagctgctaccaagatcctgttacttta
cagcttgcctgtgtttgtgatcctggatacattggttccagatgtgacgactgtgcctca
ggatactttggtaatccatcagaagttggggggtcatgtcagccttgccagtgtcacaac
aacattgacgcgacagacccagaagcctgtgacaaggagactgggaggtgtctcaagtgc
ctgtaccacacggaaggggaacactgtcagttctgccggtttggatactatggtgatgcc
ctccggcaggactgtcgaaagtgtgtctgtaattacctgggcactgtgcaagagcactgt
aatggctctgactgccagtgcgacaaagccactggtcagtgcttgtgtcttcctaatgtg
atcgggcagaactgtgaccgctgtgcgcccaatacctggcagctggccagtggcactggc
tgtgacccatgcaactgcaatgctgctcattccttcgggccatcttgcaatgagttcacg
gggcagtgccagtgcatgcctgggtttggaggccgcacctgcagcgagtgccaggaactc
ttctggggagaccccgatgtggagtgccgagcctgtgactgtgaccccaggggcattgag
acaccacagtgtgaccagtccacgggccagtgtgtctgcgttgagggtgttgagggtcca
cgctgtgacaagtgcacgcgagggtactcgggggtcttccctgactgcacaccctgccac
cagtgctttgctctctgggatgtgatcattgccgagctgaccaacaggacacacagattc
ctggagaaagccaaggccttgaagatcagtggtgtgatcgggccttaccgtgagactgtg
gactcggtggagaggaaagtcagcgagataaaagacatcctggcgcagagccccgcagca
gagccactgaaaaacattgggaatctctttgaggaagcagagaaactgattaaagatgtt
acagaaatgatggctcaagtagaagtgaaattatctgacacaacttcccaaagcaacggc
acagccaaagaactggattctctacagacagaagccgaaagcctagacaacactgtgaaa
gaacttgctgaacaactggaatttatcaaaaactcagatattcggggtgccttggatagc
attaccaagtatttccagatgtctcttgaggcagaggagagggtgaatgcctccaccaca
gaacccaacagcactgtggagcagtcagccctcatgagagacagagtagaagacgtgatg
atggagcgagaatcccagttcaaggaaaaacaagaggagcaggctcgcctccttgatgaa
ctggcaggcaagctgcaaagcctagacctttcagctgctgccgaaatgacctgtggaaca
cccccaggggcctcctgttccgagactgaatgtggcgggccaaactgcagaactgacgaa
ggagagaagaagtgtggggggcctggctgtggtggtctggttactgttgcacacaatgcc
tggcagaaagccatggacttggaccaagatgtcctgagtgccctggctgaagtggaacag
ctctccaagatggtctctgaagcaaaactgagggcagatgaggcaaaacagagtgctgaa
gacattctgttgaagacaaatgctaccaaagaaaaaatggacaagagcaatgaggagctg
agaaatctaatcaagcaaatcaggaactttttgacccaggatagtgctgatttggacagc
attgaagcagttgctaatgaagtattgaaaatggagatgcctagcaccccacagcagtta
cagaacttgacagaagatatacgtgaacgagttgaaagcctttctcaagtagagattatt
ctacagcagagtgctgctgacattgccagagctgagatgttgttagaagaagctaaaaaa
gcaagcaaaagtgcaacagatgttaaagtcactgcagatatggtaaaggaagctctggaa
gaagcagaaaaggcccaggtcgcagcagagaaggcaattaaacaagcagatgaagacatt
caaggaacccagaacctgctaacttcgattgagtctgaaacagcagcttctgaggaaacc
ttgttcaacgcgtcccagcgcatcagcgagttagagaggaatgtggaagaacttaagcgg
aaagctgcccaaaactctggggaggcagaatatattgaaaaagtagtatatactgtgaag
caaagtgcagacgatgtcaagaagactttacatggtgaacttgatgaaaagtataaaaaa
gtagaaaatttaattgccaaaaaaactgaagagtcagctgatgccagaaggaaagctgaa
atgctacaaaatgaagcaaaaactcttttagctcaagcaaatagcaagctgcaactgctc
aaagatttagaaagaaaatatgaaggcaatcaaaaatacttagaagataaagctcaagaa
ttagcgagactggaaggagaagtccgttcactcctaaaggatataagccagaaagttgct
gtgtatagcacatgcttgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100458901
Entry
100458901         CDS       T01416                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2 isoform X1
  KO
K05637  laminin, alpha 1/2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100458901 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100458901 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100458901 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458901 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100458901 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100458901 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100458901 (LAMA2)
   05414 Dilated cardiomyopathy
    100458901 (LAMA2)
   05416 Viral myocarditis
    100458901 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100458901 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100458901 (LAMA2)
   05145 Toxoplasmosis
    100458901 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 LXG DUF948
Other DBs
NCBI-GeneID: 100458901
NCBI-ProteinID: XP_024104095
LinkDB
Position
6
AA seq 3122 aa
MPGAAGVLLLLLLSGGLGGVQAQRPQQQRQSQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRNLSLNIHGKYIGGGVCINCTQNTAGINCETCIDGFFRPKGVSPNYPRPCQPCHCDPIG
SLNEVCVKDEKHARRGLAPGSCHCRTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLSGRIRVAPQQDGLDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDVEEEEEDTERVLQLMIILEGNDLRISTAQDKVYLHPSEEHINVLLLEEESF
TIHGTHFPVSRKEFMTVLANLKRVLLQITYSLGMDAIFRLSSVNLESAVSYPTDGSVAAA
VEVCQCPPGYTGSSCESCWPRHRRVNSTIFGGICEPCQCFGHAESCDDVTGECLNCKDHT
GGPYCDKCLPGFYGDPTKGTSEDCQPCACPLNIPSNNFSPMCHLDRSLGLICDGCAVGYT
GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKAGTTGRYCEL
CADGYFGDAVDAKNCRPCRCNASGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQS
ARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLG
NNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCN
CHPKFSGAKCTECSRGYWNYPRCNLCDCFLPGTDAATCDSETKKCSCSDQTGQCTCKVNV
EGIHCDRCRPGKFGLEAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDE
ALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE
AREEIGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRV
HTTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRRTAVTPPADLIEKC
DCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQ
HHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRG
YEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC
KRWHAREGWECVFCGDECTGLLLGDLTRLEQMVMSINLTGPLPAPYKMLYGLENMTQELK
HLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGE
FIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIA
EDELVAAEALLKKVKKLFGESRGENEEMEKNLWEKLADYKNKVDDAWDLLREATDKIREA
NRLFAVNQRNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQ
TKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFN
ATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGSLQKSFRILNE
AKKLANDVKENEDHLNGLKTKIENADARNGDLLRALNDTLGKLSAIPNDTAAKLQAVKDK
ARQANDTAKDVLAQIKELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVK
NLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKP
EIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYP
DLTIDDSYWYRIVASRTGRNGTISVRALDGPKASIVPSTYHSTSPPGYTILDVDANAMLF
VGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGT
IQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKV
SYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGL
DLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKG
CSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQ
TGQAYYAILLNRGRLEVHLSTGARTMRKIVVRPEPNLFHDGREHSVHVERTRGIFTVQVD
ENRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCVWNLVINSVPMDFARPV
SFKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTAVLTHGPCAAESEPALL
IGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRN
GLPYFSYDLGSGDTHTMIPTKINDGQWHKIKVMRSKQEGILYVDGASNRTISPKKADILD
VVGMLYVGGLPINYTTRRIGPVTYSIDGCIRNLHMAEAPANLEQPTSSFHVGTCFANAQR
GTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRTTGVLLGISSQKLDGMGIEMIDEKLMFH
VDNGAGRFTAVYDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADT
NDPVFVGGFPDDLKQFGLTTSIRFRGCIRSLKLTKSTGKPLEVDFAKALELRGVQPVSCP
AN
NT seq 9369 nt   +upstreamnt  +downstreamnt
atgccgggagccgccggggtcctcctcctcctgctgctctccggaggcctcgggggcgta
caggcgcagcggccgcagcagcagcggcagtcacaggcacatcagcaaagaggtttattc
cctgctgtcctcaatcttgcttctaatgctcttatcacgaccaatgcaacatgtggagaa
aaaggacctgaaatgtactgcaaattggtagaacatgtccctgggcagcctgtgaggaac
ccgcagtgtcgaatctgcaatcaaaacagcagcaatccaaaccagagacacccaattaca
aatgctattgatggaaagaacacttggtggcagagtcccagcattaagaatggaatcgaa
taccattatgtgacaattacactggatttacagcaggtgttccagatcgcgtatgtgatt
gtgaaggcagctaactccccccggcctggaaactggattttggaacgctctcttgatgat
gttgaatacaagccctggcagtatcatgctgtgacagacacggagtgcctaaccctttac
aatatttatccccgcactgggccaccgtcatatgccaaagacgatgaggtcatctgcact
tcattttactccaagatacaccccttagaaaatggagagattcacatctctttaatcaat
gggagaccaagtgccgatgatccttctccagaactgctggaatttacctccgctcgctat
attcgcctgagatttcagaggatccgcacactgaatgctgacttgatgatgtttgctcac
aaagacccaagagaaattgaccccattgtcaccagaagatactactactcggtcaaggat
atttcggttggagggatgtgcatctgctatggtcatgccagggcttgtccacttgatcca
gcgacaaataaatctcgctgtgagtgtgagcataacacatgtggcgatagctgtgatcag
tgctgtccaggattccatcagaaaccctggagagctggaacttttctgactaaaactgaa
tgtgaagcatgcaattgtcatggaaaagctgaagaatgctattatgatgaaaatgttgcc
agaagaaatctgagtttgaatatacatggaaagtacatcggagggggtgtctgcattaat
tgtacccaaaacactgctggtataaactgcgagacatgtattgatggcttcttcagaccc
aaaggggtatctccaaattatccaaggccatgccagccatgtcattgcgatccaattggt
tccttaaatgaagtctgtgtcaaggatgagaaacatgctcgacgaggtttggcacctgga
tcctgtcattgcagaactggttttggaggtgtgagctgtgatcggtgtgccaggggctac
actggctacccagactgcaaagcctgtaactgcagtgggttagggagcaaaaatgaggat
ccttgttttggcccctgtatctgcaaggagaatgttgaaggaggagactgtagtcgttgc
aaatccggcttcttcaatttgcaagaggataattggaaagggtgcgatgaatgtttctgt
tcaggggtttcaaacagatgtcagagttcctactggacctatggcaaaatacaagatatg
agtggctggtatctgactgacctttctggccgcattcgagtggctccccagcaggacggc
ttggactcacctcagcagatcagcatcagtaacgcggaggcccggcaagccctgccgcac
agctactactggagcgcgccggctccctatctgggaaacaaactcccagcagtaggagga
cagttgacatttaccatatcatatgacgttgaagaagaggaagaagatacagaacgtgtt
ctccagcttatgattatcttagagggtaatgatttgagaatcagcacagcccaagataag
gtgtacctgcacccatctgaagaacatattaatgtattgttacttgaagaagaatcattt
accatacatggcacacattttccagtcagtagaaaggaattcatgacagtgcttgcaaat
ttgaagagagtcctcctacaaatcacatacagcttggggatggatgccatcttcaggttg
agctctgttaaccttgaatccgctgtctcctatcctactgatggaagcgttgcagcagct
gtagaagtgtgtcagtgtccaccagggtatactggctcctcttgtgaatcttgttggcct
aggcacaggcgagttaacagcactatttttggtggcatctgtgagccatgtcagtgcttt
ggtcatgcagagtcctgtgatgacgtcactggagaatgcctgaactgtaaggatcacaca
ggtggcccatactgtgataaatgtcttcctggtttctatggcgatcctactaaaggaacc
tctgaagactgtcaaccctgtgcctgtccactcaatatcccatccaataactttagccca
atgtgccatttagaccggagtcttggattgatctgtgatggatgcgctgttgggtacaca
ggaccacgctgtgagaggtgtgcagaaggctattttggacaaccctctgtacctggagga
tcatgtcagccatgccaatgcaatgacaaccttgacttctccatccctggaagctgtgac
agcttgtctggctcctgtctgatatgtaaagcaggtacaacaggccggtactgtgagctc
tgtgctgatggatattttggagatgcagttgatgcaaagaactgtcggccctgtcgctgt
aatgccagtggctctttctctgaggtttgccacagtcaaactggacagtgtgagtgcaga
gccaacgtgcagggtcagagatgtgacaaatgcaaggctgggacctttggcctacaatca
gcaaggggctgtgttccctgtaactgcaattcttttgggtctaagtcattcgactgtgaa
gagagtggacaatgttggtgccaacctggagtcacagggaagaaatgtgaccgctgtgcc
cacggctatttcaacttccaagaaggaggctgcacagcttgtgaatgttctcatctgggt
aataattgtgacccaaagactgggcgctgcatttgccctcccaataccattggagagaaa
tgttctaaatgtgcacccaatacctggggccacagcattaccactggttgtaaggcttgt
aactgcagcacagtgggatccttggatttccaatgcaatgtaaatacaggccaatgcaac
tgtcatccaaaattctctggtgcaaaatgtacagagtgcagtcgaggttactggaactac
cctcgctgcaatctgtgtgactgcttcctccctgggacggatgccgcaacctgtgattca
gagactaaaaaatgctcctgtagtgatcaaactggacagtgcacttgtaaggtgaatgtg
gaaggcatccactgtgacagatgccggcctggcaaattcggacttgaggccaagaatcca
cttggctgcagcagctgctattgcttcggcactactacccagtgctctgaagcaaaagga
ctgatccggacgtgggtgactctgaaggctgagcagaccattctacccctggtagatgag
gctctgcagcacacaaccaccaagggcattgtttttcaacatccagagattgttgcccac
atggatctgatgagagaagatctccatttggaacctttttattggaaacttccagaacaa
tttgaaggaaagaagttgatggcctatgggggcaaactcaagtatgcaatctatttcgag
gctcgggaagaaataggtttctctacatataatcctcaagtgatcattcgaggtgggaca
cctactcatgctagaattatcgtcaggcatatggctgctcctctgattggccaattgaca
aggcatgaaattgaaatgacagagaaagaatggaaatattatggggacgatcctcgagtc
catacaactgtgacccgagaagacttcttggatatactatatgatattcattacattctt
atcaaagctacttatggaaatttcatgcgacaaagcaggatttctgaaatctcaatggag
gtagctgaacaaggacgtagaacagcagtgactcctccagctgacttgattgaaaaatgt
gattgtcccctgggctattctggcctgtcctgtgaggcatgcttgccaggattttatcga
ctgcgttctcaaccaggtggccgcacccctggaccaaccctgggcacctgtgttccatgt
caatgtaatggacacagcagcctgtgtgaccctgaaacatcgatatgccagaattgtcaa
catcacactgctggtgacttctgtgaacgatgtgctcttggatactatggaattgtcaag
ggattgccaaatgactgtcagcaatgtgcctgccctctgatttcttccagtaacaatttc
agcccctcttgtgtcgcagaaggccttgatgactaccgctgcacggcttgtccacgggga
tacgaaggccagtactgtgaaaggtgtgcccctggctatactggcagtccaagcagccct
ggaggctcctgccaagaatgtgagtgtgatccctatggctcactgcctgtgccctgtgac
cctgtcacaggattctgcacgtgccgacccggagccacgggaaggaagtgtgacggctgc
aagcgctggcatgcacgcgagggctgggagtgtgttttttgtggagatgagtgcactggc
cttcttctcggtgacttgactcgcctggagcagatggtcatgagcatcaacctcactggt
ccgctgcctgcgccatataaaatgctgtatggtcttgaaaatatgactcaggagctaaag
cacttgctctcacctcagcgggccccagagaggcttattcagctggcagagggcaatctg
aatacactcgtgaccgaaatgaatgagctgctgaccagggctaccaaagtgacagcagat
ggtgagcagaccggacaggatgctgagaggaccaacacaagagcaaagtccctgggagaa
ttcattaaggagcttgcccgggatgcagaagctgtaaatgaaaaagctataaaactaaat
gaaactctaggaactcgagacgaggcctttgagagaaatttggaagggcttcagaaagag
attgaccagatgattaaagaactgaggaggaaaaatctagagacacaaaaggaaattgct
gaagatgagttggtagctgcagaagcccttctgaaaaaagtgaagaagctgtttggagag
tcccggggggaaaatgaagaaatggagaagaatctctgggaaaaactggctgactacaaa
aacaaagttgatgatgcttgggacctgttgagagaagccacagataaaatcagagaagct
aatcgcttatttgcagtaaaccagagaaacatgactgcattggagaaaaagaaggaggct
gttgaaagtggcaaacgacaaattgagaacactttaaaagagggcaatgacatactcgat
gaagccaaccgtcttgcagatgaaatcaactccatcatagactatgttgaagacatccaa
accaaattgccacctatgtctgaggagcttaatgataaaatagatgacctctcccaagaa
ataaaggacaggaagcttgctgagaaggtgtcccaggctgagagtcacgcagctcagttg
aatgactcatctgctgtccttgatggaatccttgatgaggctaaaaacatctccttcaat
gccactgcagccttcaaagcttacagcaatatcaaggactatattgatgaagctgagaaa
gttgccaaagaagccaaagatcttgcacatgaagccacaaaactggcaacaggtcctcgg
ggtttattaaaggaagatgccaaaggctctcttcagaaaagcttcaggattcttaacgaa
gccaagaagttagcaaatgatgtaaaagaaaatgaagaccatctaaatggcttaaaaacc
aagatagaaaatgctgatgctagaaatggggatctcttgagagctttgaatgacactttg
ggaaagttatcagctattccaaatgacacagctgctaaactgcaagctgttaaggacaaa
gccagacaagccaacgacacagctaaagatgtactggcacagattaaagagctccaccag
aacctcgatggcctgaagaagaattacaataaactagcagacagcgtcgccaaaacaaat
gctgtggttaaagatccttccaagaacaaaatcattgccgatgcagatgccactgtcaaa
aatttagaacaggaagctgaccggctaatagataaactcaaacccatcaaggaacttgag
gataacctaaagaaaaacatctctgagataaaggaattgataaaccaagctcggaaacaa
gccaattctatcaaagtatctgtgtcttcaggaggtgactgcattcgaacatacaagcca
gaaatcaagaaaggaagttacaataatattgttgtcaacgtaaagacagctgttgctgat
aacctcctcttttatcttggaagtgccaaatttattgactttctggctatagaaatgcgt
aaaggcaaagtcagcttcctctgggatgttggatctggagttggacgtgtagagtaccca
gatttgactattgatgactcatattggtaccgtatcgtagcatcaagaactgggagaaat
ggaactatttctgtgagagccctggatggacccaaagccagcattgtgcccagcacgtat
cattcgacgtctcctccagggtacactattctagatgtggatgcaaatgcaatgctgttt
gttggtggcctgactgggaaattaaagaaggctgatgctgtacgtgtgattacattcact
ggctgcatgggagaaacatactttgacaacaaacctataggtttgtggaatttccgagaa
aaagaaggtgactgcaaaggatgcactgtcagtcctcaggtggaagatagtgaggggact
attcagtttgatggagaaggttatgcattggtcagccgccccattcgctggtaccccaac
atctccaccgtcatgttcaagttcagaacattttcttcgagtgctcttctgatgtatctt
gccacacgagacctgagagatttcatgagtgtggagctcactgatgggcacataaaagtc
agttatgatctgggctcaggaatggcttccgttgtcagcaatcaaaaccataatgatggg
aaatggaaatcattcaccctgtcaagaattcaaaaacaagccaatatatcaattgtagat
atagatactaatcaggaggagaacatagcaacttcgtcttctggaaacaacttcggtctt
gacttgaaagcagatgacaaaatatattttggtggcctgccaacgctgagaaacttgagt
atgaaagcaaggccagaagtaaatctgaagaaatattccggctgcctcaaagatattgaa
atttcaagaactccatacaatatactcagtagtcccgattatgttggtgttaccaaagga
tgttccctggagaatgtttacacagttagctttcctaagcctggttttgtggagctctcc
cctgtgccaattgatgtaggaacagaaatcaacctgtcattcagcaccaagaatgagtcc
ggcatcattcttttgggaagtggagggacaccagcaccacctaggagaaaacgaaggcag
actggacaggcctattatgcaatactcctcaacaggggccgtctggaagtgcatctctcc
acaggggcacgaacaatgaggaaaattgtcgtcagaccagagccgaatctgtttcatgat
ggaagagaacattccgttcatgtagagcgaactagaggcatctttacagttcaagtcgat
gaaaacagaagatacatgcaaaacctgacagttgaacaacctattgaagttaaaaagctt
ttcgttgggggtgctccgcctgaatttcaaccttccccactcagaaatattcctcctttt
gaaggctgtgtatggaatcttgttattaactctgtccccatggactttgcaaggcctgta
tccttcaaaaacgctgacattggtcgctgtgcccatcagaaactccgtgaagatgaagat
ggagcagctccagctgaaatagttatccagcctgagccagttcccaccccagcctttcct
acgcccaccgcagttctgacacatggtccttgtgctgcagaatcagaaccagctcttttg
atagggagcaagcagttcgggctttcaagaaacagtcacattgcaattgcatttgatgac
accaaagttaaaaaccgtctcacaattgagttggaagtaagaaccgaagctgaatccggc
ttgcttttttacatggctcgcatcaatcatgctgattttgcaacagttcagctgagaaac
ggattgccctacttcagctatgacttggggagtggggacacccacaccatgatccccacc
aaaatcaatgatggccagtggcacaagattaaggtaatgagaagtaagcaagaaggaatt
ctttacgtagatggggcctccaacagaaccatcagtcccaaaaaagctgacatcctggat
gtcgtgggaatgctgtatgttggtgggttacccatcaactacactacccgaagaattggt
ccagtgacctatagcattgatggctgcatcaggaatctccacatggcagaggcccctgcc
aatctggaacagcccacctccagcttccatgttgggacatgttttgcaaatgctcagagg
ggaacatattttgacggaaccggttttgccaaagcagttggtggattcaaagtgggattg
gaccttcttgtagaatttgaattccgcacaactagaacgactggagttcttctggggatc
agtagtcaaaaactggatggaatgggtattgaaatgattgatgaaaagttgatgtttcat
gtggacaatggcgcgggcagattcactgctgtctatgatgctggggttccagggcatttg
tgtgatggacaatggcataaagtcactgccaacaagatcaaacaccgcattgagctcaca
gtcgatgggaaccaggtggaagcccaaagcccaaacccagcatctacatcagctgacaca
aatgaccctgtgtttgttggaggcttcccagatgaccttaagcagtttggcctgacaacc
agtattcggttccgaggttgcatcagatccctgaagctcaccaaaagcacgggcaagcca
ctggaggttgattttgccaaggccctggaactgaggggcgttcaacctgtatcatgccca
gccaactaa

KEGG   Pongo abelii (Sumatran orangutan): 100461994
Entry
100461994         CDS       T01416                                 

Gene name
LAMB4
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit beta-4
  KO
K06245  laminin, beta 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100461994 (LAMB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100461994 (LAMB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100461994 (LAMB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461994 (LAMB4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100461994 (LAMB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100461994 (LAMB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100461994 (LAMB4)
   05145 Toxoplasmosis
    100461994 (LAMB4)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N
Other DBs
NCBI-GeneID: 100461994
NCBI-ProteinID: XP_024105656
Ensembl: ENSPPYG00000017908
LinkDB
Position
7
AA seq 1761 aa
MQFQLTLFLHLGWLSYSKAQDDCNRGACHPTTGDLLVGRNMQLTASSTCGLSRAQKYCIL
SYLEGEQKCFICDSRFPYDPYAQPNSHTIENVIVSFEPDREKKCWQSENGLDHVSIRLDL
EALFRFSHLILTFKTFRPAAMLVERSTDYGHTWKVFKYFAKDCATSFPNITSGQAQGVGD
IVCDSKYSDIEPSTGGEVVLKVLDPSFETEXPYSPYIQDLVTLTNLRINFTKLHTLGDTL
LGRRQHDSLDKYYYALYEMIVRGSCFCNGHASECRPMQKMRGDVFSPPGMVHGQCVCQHN
TDGPNCERCKDFFQDVPWRPAADLQDNACRSCSCNSHSSRCHFDMTTYLASGGLSGGVCE
DCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPALRSVA
GQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLPFLTCDVDTGQCLCLSY
VTRAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNVCSPKNGQCECRPHVTGRSCSEPA
PGYFFAPLNFYLYEAEEATPLQGLAPLGSETFGQSPAVHVVLGEPVPGNPVTWTGPGFAR
VLPGAGLRFAVNNIPFPVDFTIAIRYETQSAADWTVQIVVNPPGGSEHCIPKSPQSKPQS
FALPVATRIMLLPTPICLEPDVQYSIDVYFSQPLEGESHAHSHVLVDSLGLIPQINSLEN
FCSKQDLDEYQLHNCVEIASAMGPQVLLGACERLIISMSAKLHDGAVACKCHPQGSVGSS
CSRLGGQCQCKPPVVGRCCDRCSTGSYDLGHHGCHPCHCHPQGSKDTVCDQVTGQCPCHG
EVSGRRCDRCLAGYFGFPSCRPCPCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPSSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNP
RISGAPCRPCACNNNIDVTDPESCSRVTGECLRCLHNTQGANCQLCKPGHYGSALNQTCR
RCSCHASGVSPMECPPGGGACLCDPVTGACPCLPNVTGLACDRCADGYWNLVPGRGCQSC
DCDPRTSQSSHCDQLTGQCPCKLGYGGKRCSECQENYYGDPPGRCIPCDCNRAGTQKPIC
DPDTGMCHCREGVSGQRCDRCARGHSQEFPTCLQCHLCFDQWDHTISSLSKAVQGLMRLA
ANMEDKRETLPVCEADFKGLRGNVSEIERILKHPVFPSGKFLKVKDYHDSVRKQIMQLNE
QLKAVYEFQDLKDTIERAKNEADLLLEDLQEEIDLQSSVLNASIVDSSENIKKYYHISSS
AEKQINETSSTINTSANTRNDLLTILDTLTSKGNLSLERLKQIKIPDIQILNEKVCGDPG
NVPCVPLPCGGALCTGWKGHRKCGGPGCHGSLTLSTNALQKAQEAKSVIHNLDKQVRGLK
NQIKNISKLAEVSKNNALQLMEKLGNIRNQSDSEEEKINLFIKKVKNFLLEENVPPEDIE
KVANGVLDIHLPIPSQNLTDELDKIQKFMQLCEDYRTDENRLNEEADGAQKLLVKAKVAE
KAANVLLNLDKTLNQLQQAQITQGRADSTITQLTANITKIKKNVLQAENQTREMKSELEL
AKQRSGLEDGLSLLQTKLQRHQDHAVDVKVQADSAQHQAGSLEKEFVELKKQYAILQRKT
STTGLTKETLGKVKQLKDAAEKLAGDTEDKIRRITDLERKIQDLNLSRQAKADQLRILED
QVVAIKNEIVEREKKYATCYS
NT seq 5286 nt   +upstreamnt  +downstreamnt
atgcaatttcaactgaccctttttttgcaccttgggtggctcagttactcaaaagctcaa
gatgactgcaacaggggtgcctgtcatcccaccactggcgatctcctggtgggcaggaac
atgcagcttacggcttcttctacctgtgggctgagcagagcccagaaatactgcatcctc
agttacctagagggggaacaaaaatgcttcatctgtgactctagatttccatatgatccg
tacgcccaacccaacagccacaccattgagaatgtcattgtaagttttgaaccagacaga
gaaaagaaatgctggcaatctgaaaatggtcttgatcatgtcagcatcagactggactta
gaggcattatttcggttcagccaccttatcttgacctttaagacttttcggcctgctgca
atgttagttgaacgttccacagactatggacacacctggaaagtgttcaaatattttgca
aaagactgtgccacttcctttcctaacatcacatctggccaggcccagggagtgggagac
attgtttgtgactccaaatactcggatattgaaccctcaacaggtggagaggttgtttta
aaagttttggatcccagttttgaaactgaanaaccttatagcccctacatccaagacctt
gtgacattgacaaacctcaggataaactttaccaagctccacacccttggggatactttg
cttggaaggaggcaacatgattcccttgataaatactactatgctctgtatgagatgatt
gttcggggaagctgcttttgcaatggccatgctagcgaatgtcgccctatgcagaagatg
cggggagatgttttcagccctcctggaatggttcacggtcagtgcgtctgtcagcacaat
acagatggtccgaactgtgagagatgcaaggacttcttccaggacgttccttggaggcca
gctgcagacctccaggacaacgcttgcagatcgtgcagctgtaacagccactccagccgc
tgtcactttgacatgactacgtacctggcaagcggtggcctcagcgggggcgtgtgtgaa
gactgccagcacaacactgaggggcagcactgcgaccgctgcaggcccctcttctacagg
gatccgctcaagaccatctcagatccctacgcgtgcattccttgtgaatgtgaccctgat
gggaccatatctggtggcatttgtgtgagccactctgatcctgccttacggtctgtggcc
ggccagtgcctttgtaaggagaacgtggaaggagccaaatgcgaccagtgcaagcccaac
cactacggactgagcgccactgaccccctgggctgccagccctgcgactgtaaccccctt
gggagtctgccattcttgacctgtgatgtggatacaggccaatgcttgtgcctgtcatat
gtcaccagagcacactgcgaagaatgcactgttggatactggggcctgggaaatcatctc
catgggtgttctccctgtgactgtgatattggaggtgcttattctaacgtgtgctcaccc
aagaatgggcaatgtgaatgccgcccacatgtcactggccgtagctgctctgaaccagcc
cctggctacttctttgctcctttgaatttctatctctatgaggcagaggaagccacacca
ctccaaggactggcacctttgggctcggagacttttggccagagtcctgctgttcacgtt
gttttaggagagccagttcctgggaacccggttacatggactggacctggatttgccagg
gttctccctggggctggcttgagatttgctgtcaacaacattccctttcctgtggacttc
accattgccattcgctatgaaacccagtctgcagctgactggactgtccagatcgtggtg
aacccccctggagggagtgagcactgcatacccaagagtccacagtcaaagcctcagtct
tttgccttaccagtggctaccagaatcatgctgcttcccacacccatctgtttagaacca
gatgtacaatattccatagatgtctatttttctcagcctttggaaggagagtcccacgct
cattcacacgtcctggtggactctcttggccttattccccaaatcaattcattggagaat
ttctgcagcaagcaggacttagatgagtatcagcttcacaactgtgttgaaattgcctca
gcaatgggacctcaagtgctcctgggtgcctgtgaaaggctgatcatcagcatgtctgcc
aagctgcatgatggggctgtggcctgcaagtgtcacccccagggctcagtcggatccagc
tgcagccgacttggaggccagtgccagtgtaaacctcctgtggtcgggcgctgctgtgac
aggtgctcaactggaagctatgatttggggcatcatggctgtcacccatgtcactgccat
cctcaaggatcaaaggacactgtatgtgaccaagtaacaggacagtgcccctgccatgga
gaggtgtctggccgccgctgtgatcgctgcctggcaggctactttggatttcccagctgc
cgcccttgcccttgtaatgggtttgctgaactttgtgatcctgagacagggtcatgcttc
aattgtggaggctttacaactggcagaaactgtgaaaggtgtattgatggttactatgga
aatccttcttcaggacagccctgtcgtccttgcctgtgtccagatgatccctcaagcaat
cagtattttgcccattcctgttatcagaatctgtggagctcagatgtaatctgcaattgt
cttcaaggttatacgggtactcagtgtggagaatgctctactggtttctatggaaatcca
agaatttcaggagcaccttgccgaccatgcgcctgcaacaacaacatagatgtaaccgat
ccagagtcctgcagccgggtaacaggggagtgccttcgatgtttgcacaacactcagggc
gcaaactgccagctctgcaaaccaggtcactatggatcagccctcaatcagacctgcaga
agatgctcctgccatgcttccggcgtgagtcccatggagtgtccccctggtgggggagct
tgcctctgtgaccctgtcactggtgcttgtccttgtctgccgaatgtcacaggactggcc
tgtgaccgttgtgctgatggatactggaatctagtccctggcagaggatgtcagtcatgt
gactgtgaccctaggacctctcaaagtagccactgtgaccagcttacaggccagtgtccg
tgtaaattaggctacggcgggaaacgttgcagtgagtgccaggaaaattattatggtgat
ccacctgggcgatgcattccatgtgattgtaacagggcaggtacccagaagcccatctgt
gatccagacacaggcatgtgccactgccgggagggtgtcagcggccagagatgtgatcgc
tgtgcccggggtcacagccaggaattccctacttgtcttcaatgtcacttgtgctttgat
caatgggaccacaccatttcttccctctccaaagcggtgcaagggttaatgagactggct
gctaacatggaagataaaagagagaccctgcctgtctgtgaggcagacttcaaaggcctc
agagggaacgtgtctgaaatagaaaggattttgaaacatcctgttttcccatctgggaaa
ttcttaaaagtcaaggattatcatgactctgttagaaaacaaatcatgcagctaaatgaa
caattgaaagcagtgtatgaatttcaagatctgaaagatacaatagaaagagcaaagaat
gaagcagacctcttacttgaagaccttcaggaagaaattgatttgcaatccagtgtcctt
aatgcaagcattgtggactcctcagaaaacatcaagaaatattatcacatatcatcatct
gctgaaaagcaaattaatgaaactagttccaccattaatacctctgcaaatacaaggaat
gacttacttaccatcttagatacactaacctcaaaaggaaacttgtcattggaaagatta
aagcagattaagataccagatatccaaatattgaatgaaaaggtgtgtggagatccagga
aatgtgccatgtgtgcccttgccctgtggcggtgctctctgcacgggctggaaggggcac
aggaagtgtgggggtcccggctgtcacggctccctgaccctctcaacgaatgccctccaa
aaagcccaggaagcaaaatccgttattcataatttggacaaacaggttcgtgggttgaag
aatcagataaaaaatataagtaaactggcagaagtctccaaaaacaatgccttacagcta
atggaaaaactgggaaatataagaaaccaaagtgactctgaagaagaaaaaatcaatctt
ttcatcaaaaaagtgaaaaactttttgttagaggaaaacgtgcctccagaagacatcgag
aaggttgcgaatggtgtgcttgatattcacctaccaattccatcccaaaatctaaccgat
gaacttgacaaaatacagaaatttatgcaactctgtgaggattacaggacagatgaaaac
aggttaaatgaagaagcagatggagcccaaaagcttttggtgaaggccaaagtagctgag
aaagcagcaaatgttctattaaatcttgacaaaacattgaaccagttacaacaagctcaa
atcactcaaggacgggcagactctaccattacacagctgactgccaatataacaaaaata
aaaaagaatgtgctgcaggctgaaaatcaaaccagggaaatgaagagtgagctggagtta
gcaaagcagcgatcagggctggaggatggactttccctgctgcagaccaagttgcaaagg
catcaagaccacgctgtcgatgtgaaagttcaggctgactctgcccaacaccaggctggg
agtcttgagaaggaatttgttgagctgaaaaaacaatatgctattctccaacgtaagaca
agcactacaggactaacaaaggagacattaggaaaagttaaacagctaaaagatgctgca
gaaaaattggctggagatacagaggacaagataagaagaataacagatttagaaaggaaa
atccaagatttgaatctaagtagacaagcaaaagctgatcaactgagaatattggaagat
caagttgttgccattaaaaatgaaattgttgaacgagaaaaaaaatatgctacttgctat
agctag

DBGET integrated database retrieval system