KEGG   Pongo abelii (Sumatran orangutan): 100434355
Entry
100434355         CDS       T01416                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04613  Neutrophil extracellular trap formation
pon04650  Natural killer cell mediated cytotoxicity
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04670  Leukocyte transendothelial migration
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon05017  Spinocerebellar ataxia
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05032  Morphine addiction
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100434355 (PRKCA)
   04012 ErbB signaling pathway
    100434355 (PRKCA)
   04014 Ras signaling pathway
    100434355 (PRKCA)
   04015 Rap1 signaling pathway
    100434355 (PRKCA)
   04310 Wnt signaling pathway
    100434355 (PRKCA)
   04370 VEGF signaling pathway
    100434355 (PRKCA)
   04066 HIF-1 signaling pathway
    100434355 (PRKCA)
   04020 Calcium signaling pathway
    100434355 (PRKCA)
   04070 Phosphatidylinositol signaling system
    100434355 (PRKCA)
   04072 Phospholipase D signaling pathway
    100434355 (PRKCA)
   04071 Sphingolipid signaling pathway
    100434355 (PRKCA)
   04151 PI3K-Akt signaling pathway
    100434355 (PRKCA)
   04150 mTOR signaling pathway
    100434355 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100434355 (PRKCA)
   04540 Gap junction
    100434355 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100434355 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    100434355 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    100434355 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    100434355 (PRKCA)
   04670 Leukocyte transendothelial migration
    100434355 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    100434355 (PRKCA)
   04929 GnRH secretion
    100434355 (PRKCA)
   04912 GnRH signaling pathway
    100434355 (PRKCA)
   04921 Oxytocin signaling pathway
    100434355 (PRKCA)
   04926 Relaxin signaling pathway
    100434355 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    100434355 (PRKCA)
   04918 Thyroid hormone synthesis
    100434355 (PRKCA)
   04919 Thyroid hormone signaling pathway
    100434355 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    100434355 (PRKCA)
   04916 Melanogenesis
    100434355 (PRKCA)
   04925 Aldosterone synthesis and secretion
    100434355 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100434355 (PRKCA)
   04270 Vascular smooth muscle contraction
    100434355 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    100434355 (PRKCA)
   04971 Gastric acid secretion
    100434355 (PRKCA)
   04972 Pancreatic secretion
    100434355 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100434355 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100434355 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100434355 (PRKCA)
   04727 GABAergic synapse
    100434355 (PRKCA)
   04725 Cholinergic synapse
    100434355 (PRKCA)
   04728 Dopaminergic synapse
    100434355 (PRKCA)
   04726 Serotonergic synapse
    100434355 (PRKCA)
   04720 Long-term potentiation
    100434355 (PRKCA)
   04730 Long-term depression
    100434355 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    100434355 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100434355 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    100434355 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100434355 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100434355 (PRKCA)
   05206 MicroRNAs in cancer
    100434355 (PRKCA)
   05205 Proteoglycans in cancer
    100434355 (PRKCA)
   05231 Choline metabolism in cancer
    100434355 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100434355 (PRKCA)
   05214 Glioma
    100434355 (PRKCA)
   05223 Non-small cell lung cancer
    100434355 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100434355 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    100434355 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100434355 (PRKCA)
   05032 Morphine addiction
    100434355 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100434355 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100434355 (PRKCA)
   05161 Hepatitis B
    100434355 (PRKCA)
   05171 Coronavirus disease - COVID-19
    100434355 (PRKCA)
   05164 Influenza A
    100434355 (PRKCA)
   05163 Human cytomegalovirus infection
    100434355 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100434355 (PRKCA)
   05143 African trypanosomiasis
    100434355 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100434355 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100434355 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100434355 (PRKCA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100434355 (PRKCA)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100434355 (PRKCA)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100434355 (PRKCA)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C C1_2 APH Kinase-like
Other DBs
NCBI-GeneID: 100434355
NCBI-ProteinID: XP_024090551
LinkDB
Position
17
AA seq 614 aa
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKDRLYFVME
YVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIK
IADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPF
DGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFR
RIDWEKLENREIQPPFKPRVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSY
VNPQFVHPILQSAV
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccagaagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgtgatcactgtgggtca
ctgctctatggacttatccatcaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacactgagaagaggggg
cggatttacctaaaggctgaggttgctgacgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccccagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaacgtacccattccggaaggggacgaagaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tccgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttggggaaggggagttttggaaaggatcggctgtacttcgtcatggag
tatgtcaacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaacca
caagcagtattctatgcggcagagatttccatcggattgttcttccttcataaaagagga
atcatttatagggatctgaagttagataatgtcatgttggattcagaaggacatatcaaa
attgctgactttggaatgtgcaaggaacacatgatggatggagtcacgaccaggaccttc
tgtgggactccagattacattgccccagagataatcgcttatcagccgtatggaaaatct
gtggactggtgggcctatggcgtcctgttgtatgaaatgcttgctgggcagcctccattt
gatggtgaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatcca
aagtccttgtccaaggaggctgtttccatctgcaaaggactgatgaccaaacacccagcc
aagcggctgggctgtgggcctgagggggagagggacgtgagagaacatgccttcttccgg
aggatcgactgggaaaaactggagaacagggagatccagccaccattcaagcccagagtg
tgtggcaaaggagcagaaaactttgacaagttcttcacacgaggacagcccgtcttaaca
ccgcctgatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtat
gtcaacccccagtttgtgcaccccatcttacagagtgcagtatga

DBGET integrated database retrieval system