KEGG   Pongo abelii (Sumatran orangutan): 100434371
Entry
100434371         CDS       T01416                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100434371 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pon04054]
    100434371 (NLRP4)
Membrane trafficking [BR:pon04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100434371 (NLRP4)
Pattern recognition receptors [BR:pon04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100434371 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 VirE AAA_22 AAA_14 ResIII DAP3 RNA_helicase AAA_25 AAA_30
Other DBs
NCBI-GeneID: 100434371
NCBI-ProteinID: XP_024092933
LinkDB
Position
19
AA seq 994 aa
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLHLELKQIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSHLWSSKSVTEIH
LYFEEEVKQEECDHLDRLFAPKETGKQPRTVVIQGPQGIGKTTLLMKLMMAWSDNKIFRD
KFLYTFYFCCRELRELAPMSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELKGGL
NEPDSDLCGDLMEKRPVQVLLSSLLRRKMLPEASLLIAVKPVCPKELRDQVTISEIYQPR
GFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LALTCQSTTSVYSSFVFNLFTHEGAEGPTPQSQHQLKALCSLAAEGMWTDTFEFCEDDLR
RNGVIDADIPVLLGTKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCV
QELLVANFEKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQFHQCLKSLGE
RGQPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEAKFHIIDNADLVVSAYCLKYCSSLR
KLCFSVQNVFEKEDEHSSTSDYSLICWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCN
QLRHPSCRLQKLGINNVSFSGQSALLFEVLFYQPDLKYLSFTLTKLSRDDIRCLCDALNY
PAGNVKELGLVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTV
LVYLMLAFCHLSEQCCEYISEMLLRNKSVRYLDLGANVLKDEGLKTLCEALKRPDCCLDS
LCLVKCFITAAGCEDLASALINNQNLKILQIGCNEIGDVGVQLLCRALTHPDCRLEILGL
EECGLTSACCKDLASVLTCSKNLQQLNLTLNALDHTGVVALCEALRHPECALQVLGLRKT
DFDEETQALLTAEEERNPNLTITDDCDTITRVEI
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggcggcctctttcttctctgattttggtcttatgtggtatctggaggagctcaaaaag
gaggagttcaggaaatttaaagaacatctcaagcaaatgactttgcatcttgaactcaag
cagattccctggactgaggtcaaaaaagcatcccgggaagaacttgcaaacctcttgatc
aagcactatgaagaacaacaagcttggaacataaccttaagaatctttcaaaagatggat
agaaaggatctctgcatgaaggtcatgagggagagaacaggatacacaaagacctatcaa
gctcacgcaaagcagaaattcagccacttatggtccagcaagtctgtcactgagattcac
ctgtactttgaggaggaagtcaagcaagaagaatgtgaccatttggaccgcctttttgct
cccaaggaaactgggaaacagccacgtacagtggtcattcaaggaccgcaaggaattgga
aaaacgacactcctgatgaagctgatgatggcctggtcggacaacaagatttttcgggat
aagttcctgtacacattctatttctgctgcagagaactgagggagttggcgccaatgagt
ttggctgacttgatttccagagagtggcctgaccccgctgctcctataacagagatcgtg
tctcaaccggagagactcttgttcgtcatcgacagcttcgaagagctgaagggcggcttg
aatgaacccgattcggatctgtgtggcgacttgatggagaaacggccggtgcaggtgctt
ctgagcagtttgctgaggaggaagatgctcccggaggcctccttgctcatcgccgtcaaa
cccgtgtgcccgaaggagctccgggatcaggtgacgatctcagaaatctaccagccccgg
ggattcaacgagagtgataggttagtgtatttctgctgtttcttcaaagacccgaaaaga
gccatggaagccttcaatcttgtaagagaaagtgaacagctgttttccatatgccaaatc
ccgctcctctgctggatactgtgtaccagtctgaagcaagagatgcagaaaggaaaagac
ctggccctgacctgccagagcactacctctgtatactcctctttcgtctttaacctgttc
acacacgagggtgccgagggcccgactccgcaaagccagcaccagctgaaggccctgtgc
tccctggctgcggagggcatgtggacagacacatttgagttttgtgaagacgacctccgg
agaaatggggttattgatgctgacatccctgtgctgctgggcaccaagatacttctgaag
tacggggagcgtgagagctcctacgtgttcctccacgtgtgtatccaggagttctgtgcc
gccttgttctatttgctcaagagccaccttgatcatcctcacccagctgtgagatgtgta
caggaattgctagttgccaattttgaaaaagcaaggagagcacattggatttttttgggg
tgttttctaactggccttttaaataaaaaggaacaagaaaaactggacgcgttttttggc
ttccaactgtcccaagagataaagcagcaatttcaccagtgcctgaagagcttaggggag
cgtggccaaccacagggacaggtggattccttggcgatattttactgtctctttgaaatg
caggatcctgcctttgtgaagcaggcagtgaacctcctccaagaagctaaatttcatatt
attgacaacgcggacttggtggtttctgcctactgcttaaaatactgctccagcttgagg
aaactctgtttttccgttcaaaatgtctttgagaaagaggatgaacacagctctacgtcg
gattacagcctcatctgttggcatcacatctgctctgtgctcactaccagcgggcacctc
agagagctccaggtacaggacagcaccctcagcgagtcgacctttgtgacctggtgtaac
cagctgaggcatcccagctgtcgccttcagaagcttggaataaataacgtttccttttct
ggccagagtgctctgctctttgaggtgctcttttatcagccagacttgaaatacctgagc
ttcaccctcacgaaactctctcgtgatgacatcaggtgcctctgtgatgccttgaactac
ccggcgggcaacgtaaaagagctagggctggtaaattgtcacctctcacccattgattgt
gaagtccttgccggccttctaaccaacaacaagaagctgacgtatctgaatgtatcctgc
aaccagttagacacaggcgtgccccttttgtgtgaagccctgtgcagcccagacacggtc
ctggtgtacctgatgttggctttctgtcacctcagtgagcaatgctgcgaatacatctct
gaaatgcttctgcgtaacaagagcgtgcgctatctagacctcggcgccaatgtcctgaag
gacgaaggactgaaaactctctgcgaggccttgaaacgcccggactgctgcctggattcg
ctatgtttggtaaaatgttttatcactgctgccggctgtgaagacctcgcctctgctctc
atcaacaatcaaaacctgaagattctgcaaattgggtgcaatgaaatcggagatgtgggc
gtgcagctgttgtgtcgggctctgacgcatccggattgccgcttagagattcttgggttg
gaagaatgtgggttaacgagcgcctgctgtaaggatctcgcgtctgttctcacctgcagt
aagaacctgcagcagctcaacctgaccttgaacgccttggaccacacaggggtggttgcg
ctctgtgaggccctgagacacccagagtgtgccctgcaggtgctcgggctgagaaaaact
gattttgatgaggaaacccaggcacttctgacggctgaggaagagagaaatcctaacctg
accatcacagacgactgtgacacaatcacaagggtagaaatctga

DBGET integrated database retrieval system