KEGG   Pongo abelii (Sumatran orangutan): 100434502
Entry
100434502         CDS       T01416                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04062  Chemokine signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04621  NOD-like receptor signaling pathway
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05022  Pathways of neurodegeneration - multiple diseases
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100434502 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100434502 (PLCB1)
   04310 Wnt signaling pathway
    100434502 (PLCB1)
   04371 Apelin signaling pathway
    100434502 (PLCB1)
   04020 Calcium signaling pathway
    100434502 (PLCB1)
   04070 Phosphatidylinositol signaling system
    100434502 (PLCB1)
   04072 Phospholipase D signaling pathway
    100434502 (PLCB1)
   04071 Sphingolipid signaling pathway
    100434502 (PLCB1)
   04022 cGMP-PKG signaling pathway
    100434502 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100434502 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100434502 (PLCB1)
   04613 Neutrophil extracellular trap formation
    100434502 (PLCB1)
   04621 NOD-like receptor signaling pathway
    100434502 (PLCB1)
   04062 Chemokine signaling pathway
    100434502 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    100434502 (PLCB1)
   04922 Glucagon signaling pathway
    100434502 (PLCB1)
   04929 GnRH secretion
    100434502 (PLCB1)
   04912 GnRH signaling pathway
    100434502 (PLCB1)
   04915 Estrogen signaling pathway
    100434502 (PLCB1)
   04921 Oxytocin signaling pathway
    100434502 (PLCB1)
   04926 Relaxin signaling pathway
    100434502 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    100434502 (PLCB1)
   04918 Thyroid hormone synthesis
    100434502 (PLCB1)
   04919 Thyroid hormone signaling pathway
    100434502 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100434502 (PLCB1)
   04916 Melanogenesis
    100434502 (PLCB1)
   04924 Renin secretion
    100434502 (PLCB1)
   04925 Aldosterone synthesis and secretion
    100434502 (PLCB1)
   04927 Cortisol synthesis and secretion
    100434502 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100434502 (PLCB1)
   04270 Vascular smooth muscle contraction
    100434502 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    100434502 (PLCB1)
   04971 Gastric acid secretion
    100434502 (PLCB1)
   04972 Pancreatic secretion
    100434502 (PLCB1)
   04973 Carbohydrate digestion and absorption
    100434502 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100434502 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100434502 (PLCB1)
   04725 Cholinergic synapse
    100434502 (PLCB1)
   04728 Dopaminergic synapse
    100434502 (PLCB1)
   04726 Serotonergic synapse
    100434502 (PLCB1)
   04720 Long-term potentiation
    100434502 (PLCB1)
   04730 Long-term depression
    100434502 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    100434502 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    100434502 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    100434502 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100434502 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100434502 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100434502 (PLCB1)
   05016 Huntington disease
    100434502 (PLCB1)
   05017 Spinocerebellar ataxia
    100434502 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100434502 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100434502 (PLCB1)
   04934 Cushing syndrome
    100434502 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100434502 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100434502 (PLCB1)
   05142 Chagas disease
    100434502 (PLCB1)
   05143 African trypanosomiasis
    100434502 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100434502 (PLCB1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100434502 (PLCB1)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100434502 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100434502 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 100434502
NCBI-ProteinID: XP_024094755
Ensembl: ENSPPYG00000010700
LinkDB
Position
20
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccctaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgcaaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacaatagcctcgccagaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
ccactttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcatttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacataagtcatcagaaggaagcggcaaaaag
aagctctcagaacaagcctccaacacctacagtgactcctccagcgtgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgacgacgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggaccgctggaagtgaggctatggccacagaagaaatg
tctaacctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccggtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacgggaagagtggctacagattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtggat
atgtttggtttgcctgtggatacaaggaggaaggcatttaagaccaaaacatcccaagga
aatgctgtgaatcctgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccagggtatcactatatctgtctaaggaatgaaagg
aaccagcctctgacgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcattgaagctttatcaaacccaatccgatatgtgaacctgatg
gaacagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagaggctccaagtgaagcgagaacgactccagca
gaaaacggggtgaatcacaccacaaccctgacacccaaaccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagaactaaagcaacagaaatcgtttgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtataatgaaattcagaatgactacttg
agaaggagagcagccttggaaaagtctgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgccctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtatatcaagaggctagaagaagcgcaaagtaaacga
caagaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggaactgggaggagacatcccaggaaaagaatttgatactcctctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100458716
Entry
100458716         CDS       T01416                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04062  Chemokine signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04621  NOD-like receptor signaling pathway
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05022  Pathways of neurodegeneration - multiple diseases
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100458716 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100458716 (PLCB2)
   04310 Wnt signaling pathway
    100458716 (PLCB2)
   04371 Apelin signaling pathway
    100458716 (PLCB2)
   04020 Calcium signaling pathway
    100458716 (PLCB2)
   04070 Phosphatidylinositol signaling system
    100458716 (PLCB2)
   04072 Phospholipase D signaling pathway
    100458716 (PLCB2)
   04071 Sphingolipid signaling pathway
    100458716 (PLCB2)
   04022 cGMP-PKG signaling pathway
    100458716 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100458716 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100458716 (PLCB2)
   04613 Neutrophil extracellular trap formation
    100458716 (PLCB2)
   04621 NOD-like receptor signaling pathway
    100458716 (PLCB2)
   04062 Chemokine signaling pathway
    100458716 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    100458716 (PLCB2)
   04922 Glucagon signaling pathway
    100458716 (PLCB2)
   04929 GnRH secretion
    100458716 (PLCB2)
   04912 GnRH signaling pathway
    100458716 (PLCB2)
   04915 Estrogen signaling pathway
    100458716 (PLCB2)
   04921 Oxytocin signaling pathway
    100458716 (PLCB2)
   04926 Relaxin signaling pathway
    100458716 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    100458716 (PLCB2)
   04918 Thyroid hormone synthesis
    100458716 (PLCB2)
   04919 Thyroid hormone signaling pathway
    100458716 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    100458716 (PLCB2)
   04916 Melanogenesis
    100458716 (PLCB2)
   04924 Renin secretion
    100458716 (PLCB2)
   04925 Aldosterone synthesis and secretion
    100458716 (PLCB2)
   04927 Cortisol synthesis and secretion
    100458716 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100458716 (PLCB2)
   04270 Vascular smooth muscle contraction
    100458716 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    100458716 (PLCB2)
   04971 Gastric acid secretion
    100458716 (PLCB2)
   04972 Pancreatic secretion
    100458716 (PLCB2)
   04973 Carbohydrate digestion and absorption
    100458716 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100458716 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100458716 (PLCB2)
   04725 Cholinergic synapse
    100458716 (PLCB2)
   04728 Dopaminergic synapse
    100458716 (PLCB2)
   04726 Serotonergic synapse
    100458716 (PLCB2)
   04720 Long-term potentiation
    100458716 (PLCB2)
   04730 Long-term depression
    100458716 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    100458716 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    100458716 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    100458716 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100458716 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458716 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100458716 (PLCB2)
   05016 Huntington disease
    100458716 (PLCB2)
   05017 Spinocerebellar ataxia
    100458716 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    100458716 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100458716 (PLCB2)
   04934 Cushing syndrome
    100458716 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100458716 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100458716 (PLCB2)
   05142 Chagas disease
    100458716 (PLCB2)
   05143 African trypanosomiasis
    100458716 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100458716 (PLCB2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100458716 (PLCB2)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100458716 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100458716 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 100458716
NCBI-ProteinID: XP_024088255
LinkDB
Position
15
AA seq 1185 aa
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDPGGE
AEGSSPPSAPAGERTVWAGEDGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYVPGAWADLTVALANPIKFFSAHDKKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKAVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELGPPGVGGVGACKLGPGKGSRKKRSLP
REESAGAAPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHAAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTADKMAQERLKREINNSHI
QEVVQVIKQMTENLEGHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACLRTCFPSEAKDKPERACECPPELCEQDPLVAKADAQESRL
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacgtatcaaagtaaggagatggagtttctggat
atcaccagcatccgggatactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgacaacagcttcctgctgaagacactcacg
gtggtgtccggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggtctgggctgaggacgtactggccctagtcaagcatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaaaaatgacgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gtgcagaggggccagctgtcacctgagggcatggtctggtttctctgtgggccagagaac
agtgtgctggctcaggacaagctgctgctccaccacgacatgacgcagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctctctggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccacggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagtgcctttaagacctccccc
tatcccatcatcctgtcgtttgagaaccacgtggactcaccccgccagcaggctaagatg
gctgagtattgccggaccatctttggggatatgctgctcacagagcccctggaaaagttc
ccgctaaaaccaggtgtccccttgcccagccccgaggatctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggccccacctcctccagtaaggatcctggtggggag
gctgagggcagcagcccacccagtgcccctgcaggtgagcgcacagtgtgggctggcgag
gatgggactgagctggaggaggaggaggtggaagaggaagaggaggaggagtcaggaaac
ctggacgaagaagagattaagaagatgcagtcggatgagggcacagcgggcctggaagtg
acggcttatgaggagatgtccagcctagtcaattacatccagcccaccaagttcatctcc
tttgagttctctgcccaaaagaaccgaagttatgtcatctcatccttcacagagctcaag
gcatatgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtgtttgagttcaacgggcagagcggctacctcctcaagcacgagttc
atgcgccggccagacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttccatcacggtgatctctgggcagttcctgtcagaacgcagcgtgcgt
acctatgtggaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtaccaactccatcaatcctgtctggaaggaggagccctttgtcttt
gagaagatcttgatgcctgagctggcctccctcagggtggctgtgatggaggaaggcaac
aagtttcttggacaccgcatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcacagtgagagcaacatgcccctcaccatgcctgcgctcttcatcttcctggag
atgaaggactacgtacctggtgcttgggcagatctcactgtggccctcgccaaccccatt
aagttcttcagtgcccatgacaagaagtctgtgaagctcaaggaggccatgggaggtctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatggggcgttggcc
ccaacgagcaatgggtcaccagcagccagggccggggccagggaagaggctatgaaagaa
gctgcggagccgcggactgccagcctggaggagctccgggagctaaaggccgtcgtgaag
ctgcagcggcggcacgagaaggagctgcgggagttggagcggcgcggagcgcggcgctgg
gaggagctgctgcagcggggcgcggcgcagctggccgagctcgggccaccgggcgtggga
ggcgttggggcctgcaagctgggtccgggcaagggctctcgcaagaagaggagcctgccc
cgcgaggagagcgccggagctgcgccgggcgagggccctgagggcgtggacgggcgcgtg
cgggagctgaaggacaggctggaactagagctgctgcggcagggcgaggagcagtacgag
tgcgttctgaagcgcaaagagcagcacgcggccgagcaaatctccaaaatgatggagctg
gccagagagaaacaggcggcagagctgaaggccctgaaggagacgtcggagaacgacacc
aaagagatgaagaaaaagctggagacgaagagactggagcggatccagggcatgaccaaa
gtcaccgcagacaagatggcccaggagaggttgaagagagagattaacaactcccacatc
caggaagtagtgcaggtgatcaagcagatgacggagaacttggaggggcaccaggagaag
ctggaggagaagcaggcggcttgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcgctggcagagtacgaggccaggatgaagggtctagaggcagaggtgaaggag
tcggtgagggcctgcctcaggacctgctttccctctgaggccaaggacaagcccgaaagg
gcctgcgagtgccccccagagctgtgtgagcaggacccactcgtagcaaaggcagatgcc
caggagagccgcctctga

KEGG   Pongo abelii (Sumatran orangutan): 100460060
Entry
100460060         CDS       T01416                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04062  Chemokine signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04621  NOD-like receptor signaling pathway
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05022  Pathways of neurodegeneration - multiple diseases
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100460060 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100460060 (PLCB3)
   04310 Wnt signaling pathway
    100460060 (PLCB3)
   04371 Apelin signaling pathway
    100460060 (PLCB3)
   04020 Calcium signaling pathway
    100460060 (PLCB3)
   04070 Phosphatidylinositol signaling system
    100460060 (PLCB3)
   04072 Phospholipase D signaling pathway
    100460060 (PLCB3)
   04071 Sphingolipid signaling pathway
    100460060 (PLCB3)
   04022 cGMP-PKG signaling pathway
    100460060 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100460060 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100460060 (PLCB3)
   04613 Neutrophil extracellular trap formation
    100460060 (PLCB3)
   04621 NOD-like receptor signaling pathway
    100460060 (PLCB3)
   04062 Chemokine signaling pathway
    100460060 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    100460060 (PLCB3)
   04922 Glucagon signaling pathway
    100460060 (PLCB3)
   04929 GnRH secretion
    100460060 (PLCB3)
   04912 GnRH signaling pathway
    100460060 (PLCB3)
   04915 Estrogen signaling pathway
    100460060 (PLCB3)
   04921 Oxytocin signaling pathway
    100460060 (PLCB3)
   04926 Relaxin signaling pathway
    100460060 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    100460060 (PLCB3)
   04918 Thyroid hormone synthesis
    100460060 (PLCB3)
   04919 Thyroid hormone signaling pathway
    100460060 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100460060 (PLCB3)
   04916 Melanogenesis
    100460060 (PLCB3)
   04924 Renin secretion
    100460060 (PLCB3)
   04925 Aldosterone synthesis and secretion
    100460060 (PLCB3)
   04927 Cortisol synthesis and secretion
    100460060 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100460060 (PLCB3)
   04270 Vascular smooth muscle contraction
    100460060 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    100460060 (PLCB3)
   04971 Gastric acid secretion
    100460060 (PLCB3)
   04972 Pancreatic secretion
    100460060 (PLCB3)
   04973 Carbohydrate digestion and absorption
    100460060 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100460060 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100460060 (PLCB3)
   04725 Cholinergic synapse
    100460060 (PLCB3)
   04728 Dopaminergic synapse
    100460060 (PLCB3)
   04726 Serotonergic synapse
    100460060 (PLCB3)
   04720 Long-term potentiation
    100460060 (PLCB3)
   04730 Long-term depression
    100460060 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    100460060 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    100460060 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    100460060 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100460060 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460060 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100460060 (PLCB3)
   05016 Huntington disease
    100460060 (PLCB3)
   05017 Spinocerebellar ataxia
    100460060 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    100460060 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100460060 (PLCB3)
   04934 Cushing syndrome
    100460060 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100460060 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100460060 (PLCB3)
   05142 Chagas disease
    100460060 (PLCB3)
   05143 African trypanosomiasis
    100460060 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100460060 (PLCB3)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100460060 (PLCB3)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100460060 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100460060 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y PLC-beta_C EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 100460060
NCBI-ProteinID: XP_024111007
Ensembl: ENSPPYG00000003111
LinkDB
Position
11
AA seq 1245 aa
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGE
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYVEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQEMCQDTQSQQL
GSQPSSNPTPSPLDASHRRPLGPTTSPTSTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGATDVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVVDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKTRDKHKKEAWRRPRSSGMTVLWLGSSRSCN
SWQKRSPSCWPSWPRSVRSSGRGSPRRSAGACWARCRRGWGTGLWWPVPAMVTHPGAAGT
CRALTPRARRRTRSSELAERGGRRARAGAGWRAGGNDTNAFFFFF
NT seq 3738 nt   +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcccaccgtcgtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgaccctgcgtgtggaccccaatggcttcttcttgtactggacgggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtatgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagacccggtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtctgaggagctgttcaagctggctatg
aacatcctggctcagaacgcctcccggaacaccttcctgcgcaaagcatacacgaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcgctggaatcctgtggcctcaaattcaaccggagt
gagtccatccggcccgatgagttttccttggaaatctttgagcggttcctgaacaagttg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgcgacccgagactcaac
gaagtgctgtacccgcccctgcggccctcccaggcccggctgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaatggcatcctgcccctggaagccctggatctgagcgcagacatgacc
cagccgctgagtgcctacttcatcaactcctcgcataacacctatctcactgcggggcag
ctggctgggacctcgtcggtggagatgtaccgccaggcactgctgtggggctgccgctgc
gtggagctggacgtgtggaagggacggccgcccgaggaggaacccttcattacccacggc
ttcaccatgaccacagaggtgcctctgcgtgacgtgctggaggccattgccgagaccgcc
ttcaagacctcaccctaccccgtcatcctctccttcgagaaccatgtggactcggcaaag
cagcaggcaaagatggctgaatactgccgctccatctttggagatgcgctactcatcgag
cctctggacaagtacccgctggccccaggcgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcaccgacccagcgcaggtggcccagacagc
gccgggcgcaagcggcccctggagcagagcaattctgccctgagcgagagctccgcggcc
accgagccctcctccccgcagcttggctctcccagctctgacagctgcccaggcctgagc
aacggggaggaggtggggcttgagaagcccagcctggagcctcagaagtctctgggcgag
gagggcctgaaccggggcccctatgttctcggacctgctgaccgtgaggatgaggaggaa
gatgaggaagaggaggaacagacagaccccaaaaagccaactacagatgagggcacggcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacgtcgagcctgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaactacatg
ccccagctcttctggaacgtagggtgccagcttgttgcactcaacttccagaccctcgat
gtggcgatgcagctcaacgcgggcgtttttgagtacaacgggcgcagcgggtacctgctc
aagccggagttcatgcggcggccggacaagtccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcagggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgacacgcggcgc
aagtaccgcacccggacctctcaggggaactcattcaaccccgtgtgggacgaggagccc
ttcgacttccccaaggtggtgctgcccacgctggcttcacttcgcatcgcagcctttgag
gaggggggtaaattcgtagggcaccggatcctgcctgtctctgccatccgctctgggtac
cactacgtctgcctgcggaacgaggccaaccaaccgctgtgcctgccggccctgcttatc
tacaccgaagcctcggactacattcctgacgaccaccaggactacgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggggagagtgaggctcaggctggccaagagatgtgccaggacacccagtctcagcagctg
gggtctcagccgtcctcaaaccccacccctagcccactggatgcctcccaccgccggccc
ctcggccccaccacctcccctaccagcacctccctcagcagtccagggcagcgcgacgat
ctcatcgctagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctctggtcaagctccggagccggcaagagcgagacctgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacccgccgcctgctggatggcctggctcaggcacag
gctgagggcaggtgccggctgcggccaggtgccctaggtggggccactgatgtggaggac
acgaaggagggggaggacgaggcaaagcggtatcaggagttccagaacagacaggtgcag
agcctgctggagctgcgggaggcccaggtggacgcagaggcccagcggaggctggaacac
ctgagacaggctctgcagcggctcagggaggtcgtcgttgatgcaaacacaactcagttc
aagaggctgaaagagatgaacgagagggagaagaaggagctgcagaagatcctggacaga
aagcgccataacagcatctcggaggccaagacgagggacaagcataagaaggaggcctgg
aggaggcccagaagcagcggcatgaccgtcttgtggctgggcagcagcaggtcctgcaac
agctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagc
gggcgaggctcccccaggagatccgccggagcctgctgggcgagatgccggaggggctgg
gggacgggcctctggtggcctgtgccagcaatggtcacgcacccgggagcagcgggcacc
tgtcgggcgctgactccgagagccaggaggagaacacgcagctctgaactggctgagcga
ggtggccgcagggccagggcgggcgctgggtggagggcaggaggcaacgacactaatgct
ttttttttttttttttaa

KEGG   Pongo abelii (Sumatran orangutan): 100461961
Entry
100461961         CDS       T01416                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04062  Chemokine signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04621  NOD-like receptor signaling pathway
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05022  Pathways of neurodegeneration - multiple diseases
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100461961 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100461961 (PLCB4)
   04310 Wnt signaling pathway
    100461961 (PLCB4)
   04371 Apelin signaling pathway
    100461961 (PLCB4)
   04020 Calcium signaling pathway
    100461961 (PLCB4)
   04070 Phosphatidylinositol signaling system
    100461961 (PLCB4)
   04072 Phospholipase D signaling pathway
    100461961 (PLCB4)
   04071 Sphingolipid signaling pathway
    100461961 (PLCB4)
   04022 cGMP-PKG signaling pathway
    100461961 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100461961 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100461961 (PLCB4)
   04613 Neutrophil extracellular trap formation
    100461961 (PLCB4)
   04621 NOD-like receptor signaling pathway
    100461961 (PLCB4)
   04062 Chemokine signaling pathway
    100461961 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    100461961 (PLCB4)
   04922 Glucagon signaling pathway
    100461961 (PLCB4)
   04929 GnRH secretion
    100461961 (PLCB4)
   04912 GnRH signaling pathway
    100461961 (PLCB4)
   04915 Estrogen signaling pathway
    100461961 (PLCB4)
   04921 Oxytocin signaling pathway
    100461961 (PLCB4)
   04926 Relaxin signaling pathway
    100461961 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    100461961 (PLCB4)
   04918 Thyroid hormone synthesis
    100461961 (PLCB4)
   04919 Thyroid hormone signaling pathway
    100461961 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    100461961 (PLCB4)
   04916 Melanogenesis
    100461961 (PLCB4)
   04924 Renin secretion
    100461961 (PLCB4)
   04925 Aldosterone synthesis and secretion
    100461961 (PLCB4)
   04927 Cortisol synthesis and secretion
    100461961 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100461961 (PLCB4)
   04270 Vascular smooth muscle contraction
    100461961 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    100461961 (PLCB4)
   04971 Gastric acid secretion
    100461961 (PLCB4)
   04972 Pancreatic secretion
    100461961 (PLCB4)
   04973 Carbohydrate digestion and absorption
    100461961 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100461961 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100461961 (PLCB4)
   04725 Cholinergic synapse
    100461961 (PLCB4)
   04728 Dopaminergic synapse
    100461961 (PLCB4)
   04726 Serotonergic synapse
    100461961 (PLCB4)
   04720 Long-term potentiation
    100461961 (PLCB4)
   04730 Long-term depression
    100461961 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    100461961 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    100461961 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    100461961 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100461961 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461961 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100461961 (PLCB4)
   05016 Huntington disease
    100461961 (PLCB4)
   05017 Spinocerebellar ataxia
    100461961 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    100461961 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100461961 (PLCB4)
   04934 Cushing syndrome
    100461961 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100461961 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100461961 (PLCB4)
   05142 Chagas disease
    100461961 (PLCB4)
   05143 African trypanosomiasis
    100461961 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100461961 (PLCB4)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100461961 (PLCB4)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100461961 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100461961 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 100461961
NCBI-ProteinID: XP_024094739
Ensembl: ENSPPYG00000010701
LinkDB
Position
20
AA seq 1206 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDARRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALRSM
MEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKASD
DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKLTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLISAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAVK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSM
KLQNAN
NT seq 3621 nt   +upstreamnt  +downstreamnt
atggccaaaccatatgaatttaactggcagaaggaagttccttcctttttgcaagaagga
gcagtatttgacagatacgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgagtttggcttctttctgacatggaaaagtgaaggcaaggaaggacaggtgcta
gaatgctccctcatcaacagtattcggtcgggagccataccaaaggatcccaaaatcttg
gctgctcttgaagctgttggaaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggcacagatctagtgaacattagttttacctacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacatttgcatcggggaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cccgcggcattttcttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatcttttcaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgattgaatgaaattttattt
ccattttatgatgccagaagggcaatgcagatcattgagatgtatgaacctgatgaagat
ttgaagaaaaaaggccttatatcaagtgatgggttttgcagatatctgatgtcagatgaa
aacgccccagtcttcctagatcgtttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagttcttcccataacacttatctcactggcagacagttcggcgggaag
tcttcggtagaaatgtacagacaggttctcctggctggttgcagatgtgttgaacttgac
tgctgggatggaaaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgtaattcaagccatcaaggaaactgcatttgtcacatca
gagtatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccacttgaaccaggcaggcctttgccatcccccaatgacctcaaaagaaaaatactcata
aaaaacaagcggctgaaacctgaagttgaaaaaaaacagctggaagctttgagaagcatg
atggaagctggagagtctgcctccccagcaaacatcttagaggacgataatgaagaggag
atcgaaagtgctgaccaagaggaggaagctcaccccgaattcaaatttggaaatgaactt
tctgctgatgacttgggtcacaaggaagctgttgcaaatagcgtcaagaaggcttcagat
gaccttgaacatgaaaacaacaaaaagggcctggtcactgtagaagatgagcaggcgtgg
atggcatcttataaatatgtaggtgctaccactaatatccatccatatttgtccacaatg
atcaactacgcccagcctgtaaagtttcaaggtttccatgtggcagaagaacgcaatatt
cattataacatgtcttcttttaatgaatcagtcggtcttggctacttgaagacacatgca
attgaatttgtcaattataacaaacggcaaatgagtcgcatttaccccaagggaggccga
gtcgattccagtaattacatgcctcagattttctggaacgctggctgccagatggtttca
ctgaactatcaaaccccagatttagcgatgcaattgaatcagggaaaatttgagtataat
ggatcgtgcgggtaccttctcaaaccagatttcatgaggcggcctgatcgaacatttgac
cccttctctgaaactcctgttgatggtgttattgcagccacttgctcagtgcaggttata
tcaggtcaattcttatcagataagaaaattggcacctacgtagaggtggatatgtatggg
ttgcccactgacaccatacgtaaggaattccgaactcgcatggttatgaataatggactc
aatccagtttacaatgaagagtcatttgtatttcggaaggtgatcctgccggacctggct
gtcttgagaatagctgtgtatgatgataacaacaagctgattggccagaggatcctcccg
cttgatggcctccaagcaggatatcgacacatttcccttcgaaatgagggaaataaacca
ttatcactgccaacaattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatattgtggatgctttatcagatccaaagaaatttctctcaattacagaaaagaga
gcagaccaaatgagagctatgggcattgagactagtgacatagccgacgtgcccagtgac
acttccaaaaatgacaagaaaggaaaggccaacactgccaaagcaaatgtgacccctcag
agtagctctgagctcagaccaaccaccacggctgccctggcctctggtgtggaagccaag
aaaggcattgaacttatccctcaagtaaggatagaagacttaaagcagatgaaggcttac
ttgaagcatttaaagaaacagcagaaggagctaaattctttaaagaagaaacatgcaaag
gaacacagtaccatgcagaagttacactgcacgcaagttgacaaaattgtggcacagtat
gacaaagagaagttgactcatgagaaaatcctagagaaggcaatgaagaagaagggggga
agtaattgtctcgaaatgaaaaaagaaacagaaattaaaattcagacgctgacatcagat
cacaaatctaaggtcaaagagattgtagcacagcacacaaaggaatggtcagaaatgatc
aatacccacagtgctgaggagcaagaaatccgagacctgcacctcagccagcagtgtgag
ctgctgaaaaagctactcatcagtgcccacgagcagcaaacccagcagctgaaactgtcc
catgacagggaaagcaaggaaatgcgagcacaccaggctaagatttctatggaaaatagc
aaagccatcagccaagataaatctatcaagaataaagcagaacgggaaaggcgagtcagg
gagttaaacagcagcaacaccaaaaagtttctggaagaaagaaagagacttgcagtgaag
cagtccaaagaaatggatcagttgaaaaaagtccagcttgaacatctagaattcctagag
aaacagaatgagcagcttttgaaatcctgtcatgcagtgtcccaaacgcaaggcgaagga
gatgcagcagatggtgaaattggaagccgagatggaccgcagaccagcaacagtagtatg
aaactccaaaatgcaaactga

DBGET integrated database retrieval system