KEGG   Pongo abelii (Sumatran orangutan): 100434751
Entry
100434751         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ral-GDS-related protein
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100434751
   04015 Rap1 signaling pathway
    100434751
   04072 Phospholipase D signaling pathway
    100434751
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100434751
   05231 Choline metabolism in cancer
    100434751
  09162 Cancer: specific types
   05210 Colorectal cancer
    100434751
   05212 Pancreatic cancer
    100434751
SSDB
Motif
Pfam: RasGEF CENP-K
Other DBs
NCBI-GeneID: 100434751
NCBI-ProteinID: XP_003780351
LinkDB
Position
Unknown
AA seq 569 aa
MFSCCILTCCRPPHRRRGQHESLSREYRHWFNSNPRRLWPFARRHPQSSTKQIKQELLDG
FNFSIFFKGQVDHATNRGQCWSAVRLGTEESPQTGLKKTRYENEICKMRTLQPSTWEKLL
ESLVPAFLTKPISPYATCLGPSWEFITVPHFLELLVRRTISSTLFTWPRENTSVCYQPPQ
RSSFWIKLAFRNFTWPGLGLEDHQEIVLGQLVLPELNKAKPDDPAPPPGQHTLTMLALEP
APPLLVDLEPALETESCAALGAPGYLHSAPGPAPAPGEGPPPGTVLEPQSAPESPCPCPS
TVKNQTSEELPDMTTFPPRLLAEQLTLMDAELFKKVVLYECLGSIWGRRHKKGNEHVAPT
VRATIAHFNRLTNCVTTSCLGNHGMRARDRARVVEHWIKVARECLSLNNFSVHAIVSALH
SNPIHRLHKTWAGVSSKSTKYLKELCKKDTAVKRDLLIKAGSFKVATQERNPQRAQMRLQ
RQKKGVVPFLGDFLTELNRLDSAIPDDLDGNIKRRKEVXVLQEMQLLHVAAMNYRLQPLE
KFVTYFPRMEQLSDKESYKLSCQLEPKSH
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgttctcctgctgtatcctgacatgttgccgacctcctcatcgcagaagaggccaacat
gaaagtctttcccgagaatacagacattggttcaactctaaccctcgacgcctctggccc
tttgccagaaggcacccacagagctccacaaagcagatcaagcaagagctgttggatgga
ttcaatttctccatcttcttcaaagggcaggtggaccatgccaccaaccgtggccagtgc
tggtctgcagtgagactgggcacagaggagtctccacagacgggactcaagaaaaccagg
tatgaaaatgagatctgcaagatgagaactctccagcccagcacatgggagaagctgttg
gagtccctggttccagcctttctaactaaacccatctccccctatgccacctgcctgggc
ccctcctgggagtttatcactgtgccacactttttggaactactagttagaagaaccatc
agctccactttgttcacctggccccgtgaaaacacttcagtttgctatcagcccccgcaa
cgatcatctttctggataaagctggccttcaggaacttcacctggcctggactgggcttg
gaggaccatcaggaaattgtcctaggccagttggtgcttccggagctcaacaaggccaag
ccagatgatcctgctccacctcctgggcaacacacattaacaatgctggccctggagcca
gcaccaccactgctggtggacctggagcctgctctggagacagagtcatgtgcagccctg
ggtgcgccagggtatctacattcagcaccagggccagcaccagcaccaggggaagggccg
ccaccagggacagtgctggagccacagtcagctccagagtccccctgtccctgtcccagc
actgtaaagaaccaaaccagtgaggagctgcctgacatgacgaccttccctcccaggctg
ctggcagagcagctgaccctcatggatgcggagctgttcaagaaggtggtgctctacgaa
tgcttgggctccatctggggccgacgacataagaaggggaatgagcacgtggcacccaca
gttcgtgccactatcgcacacttcaacaggctcaccaactgtgtcaccacctcctgcctt
gggaaccacggcatgagggcccgggacagggccagggtggtggagcactggatcaaggtg
gccagggagtgcctaagcctcaacaacttctcggtgcacgccatcgtctctgctctgcac
agcaacccaatacatcggctacacaagacgtgggcaggagtgtccagcaaaagcacaaaa
tatctaaaagaactctgcaaaaaagacactgcagtgaagagggacctgctgatcaaggcg
gggagctttaaggtggccacccaggagaggaacccccagagagcccagatgaggctgcag
aggcagaagaaaggtgtggtccccttcctgggggattttctgactgagttaaacaggttg
gattcggccatcccggatgatctggatggcaacatcaagaggaggaaagaggtttgagtt
ctgcaggaaatgcagctgctccacgtggctgccatgaattacaggcttcagcctcttgag
aaatttgtcacctatttcccaagaatggagcagctcagtgacaaggagagctacaagctg
tcctgccagctagagcccaaatcccactag

KEGG   Pongo abelii (Sumatran orangutan): 100451493
Entry
100451493         CDS       T01416                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100451493 (RALGDS)
   04015 Rap1 signaling pathway
    100451493 (RALGDS)
   04072 Phospholipase D signaling pathway
    100451493 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451493 (RALGDS)
   05231 Choline metabolism in cancer
    100451493 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100451493 (RALGDS)
   05212 Pancreatic cancer
    100451493 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 100451493
NCBI-ProteinID: XP_024108061
Ensembl: ENSPPYG00000019723
LinkDB
Position
9
AA seq 912 aa
MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRP
ESSTQEIGEELINGVIYSISLRKVQLHHGANKGQRWLGYENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCVL
PYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLEHSEPTEAEPEALSPVPALKPTPELELALTPARAPSPVPAPAPEPAPTPAPG
SELEVAPAPAPELQQAPEPAVGLELAPAPALELEPAPEQDPAPSQTLELEPAPAPVPSSE
PSWPSPVVAENGLSEEKPHLLAFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKG
KEHLAPTIRATVTQFNSVANCVITTCLGDRSTKAPDRARVVEHWIEVARECRILKNFSSL
YAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFAT
LEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVI
AQIKLLQSACNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKKNT
AIVKRWSDRQTPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVEEI
NISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVSGL
CNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEE
PEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRM
KQKGLKIAKGIF
NT seq 2739 nt   +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaggctgccgggcctgctggcggcgccgagccgctgttt
ccgggctcccggcggagccgcagcgtgtgggacgccgtgcgcctggaggtgggcgtcccc
gacagctgcccggtggtgctgcacagcttcacgcagctagaccctgacctgccgcgcccg
gagagctccacgcaggagatcggtgaggagctgattaacggagtcatctactccatctcc
ctgcgcaaggtgcagctgcaccacggagccaacaagggccagcgctggctcgggtatgag
aatgagtcggccctgaacctttatgagacttgcaaggtgcggaccgtgaaggctggcaca
ctggagaagctggtggagcacctggtgcccgccttccagggcagcgacctctcctacgtc
accatcttcctgtgtacctacagagctttcaccaccacccaacaagtcctggacctgctg
ttcaaaaggtacggtagatgtgacgccctcacggcctcctctagatacggctgcgtcctc
ccctattccgacgaagatggcggaccccaggaccaacttaaaaatgccatctcctccatc
ctgggcacctggctggaccagtactcggaggatttctgtcaacctccggacttcccctgc
ctcaagcagctggtggcctacgtgcagctcaacatgccaggctcagacctggagcgccgt
gcccaccttctcctggcccagctggagcactcggaacccactgaggcagagcctgaggct
ctgtcaccagtgccagctctaaaaccaactccagagctcgagctagctctaacaccagct
cgagcacccagcccagtgccagctccagccccagagccagctccaacaccagctccaggt
tcagagctagaagtagctccagcaccagctccagagctccagcaggctccagagccagct
gtgggactggaactggctccagcgccagctctggaactagagccagctccagaacaggat
ccagctccctcacaaactctagagctggagccagctccagcgccagttccatcatcagag
ccttcgtggccttcacctgtggttgcagagaacgggctgagtgaagagaagcctcacctc
ttggcgttccctcccgatctggtggcagagcagtttacactgatggatgcggaactgttc
aagaaggtggtgccctaccactgcctgggctccatctggtcccagcgggacaagaagggc
aaggagcacctggcgcccaccatccgcgccaccgtcacccagttcaacagtgtggccaac
tgcgtcatcaccacctgcctcggggaccgaagcacgaaagccccagacagggccagggtg
gtggagcactggatcgaggtggccagggagtgccggatcctcaagaacttctcgtcactg
tatgccatcctctctgccctgcagagcaactctatccaccgtctgaagaagacgtgggaa
gacgtttccagggacagtttccggatctttcagaagctgtcggagatcttctcagatgag
aacaactactcattgagccgggagctgctcatcaaggaggggacctccaagtttgccacc
ctggagatgaaccccaagagagcccagaaacggccaaaggagacgggcatcatccagggc
accgttccctacctgggcacattcctcaccgacctggtgatgctggacaccgccatgaag
gactatctgtatggcagactcatcaacttcgagaagaggaggaaggagttcgaggtgatc
gcccagatcaagctgctgcagtcggcctgcaacaactacagcatcgcgccagatgagcaa
tttggggcctggttccgggccgtggagcggctcagcgagactgagagctacaacctgtcg
tgtgagctggagcccccatccgagtcagccagcaacaccctcaggaccaagaagaacaca
gccattgtcaagcgctggagcgaccgccagacccccagcactgagctcagtaccagtggc
agctcccactccaagtcctgtgaccagctcaggtgtggcccctacctcagcagcggggac
attgctgacgcactcagcgtgcactcggccggctcctctagctccgatgtggaggagatc
aacatcagcttcgtcccggagtctcctgatggccaggaaaagaagttctgggaatcagcc
tcacagtcatctccggagacctccggcatcagctcggcctccagcagcacctcgtcctcc
tcagcctccaccacacccgtggctgccacgcgcacccacaagcgctccgtctcagggctc
tgcaactccagctccgcgctgccgctctacaaccagcaggtgggcgactgctgtatcatc
cgcgtcagcctggacgtggacaacggcaacatgtacaagagcatcctggtgaccagccaa
gataaggctccagccgtaatccgcaaggccatggacaaacacaacctggaggaggaggag
ccggaggactatgagctgctgcagattctctcagatgaccggaagctgaagatccctgaa
aacgccaacgtcttctatgccatgaactctaccgccaattatgactttgtcctgaagaag
cggaccttcaccaagggagtgaaggtcaagcatggagccagctcaaccctccctcgcatg
aagcagaagggactcaagattgccaagggcatcttctga

DBGET integrated database retrieval system