KEGG   Pongo abelii (Sumatran orangutan): 100434811
Entry
100434811         CDS       T01416                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05132  Salmonella infection
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100434811 (TCF7L2)
   04390 Hippo signaling pathway
    100434811 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100434811 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100434811 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100434811 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100434811 (TCF7L2)
   05225 Hepatocellular carcinoma
    100434811 (TCF7L2)
   05226 Gastric cancer
    100434811 (TCF7L2)
   05216 Thyroid cancer
    100434811 (TCF7L2)
   05221 Acute myeloid leukemia
    100434811 (TCF7L2)
   05217 Basal cell carcinoma
    100434811 (TCF7L2)
   05215 Prostate cancer
    100434811 (TCF7L2)
   05213 Endometrial cancer
    100434811 (TCF7L2)
   05224 Breast cancer
    100434811 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100434811 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100434811 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100434811 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100434811 (TCF7L2)
   05165 Human papillomavirus infection
    100434811 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100434811 (TCF7L2)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100434811 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100434811
NCBI-ProteinID: XP_024109205
LinkDB
Position
10
AA seq 624 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPP
HMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLN
AFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYP
GWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNN
WCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLS
LSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTS
SLHSHSSLAGTQPQPLSLVTKSLE
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgaacaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagacaaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccggcagcacacattactctgcgtac
aaaacgattgaacaccagattgcagttcagtatctccagatgaaatggccactgcttgat
gtccaggcagggagcctccagagtagacaagccctcaaggatgcccggtccccatcgccg
gcacacattgtctcgaacaaagtgccagtggtgcagcaccctcaccatgtccaccccctc
acgcctcttatcacgtacagcaatgaacacttcacgccgggaaacccacctccacactta
ccagccgacgtagaccccaaaacaggaatcccacggcctccgcaccctccagatatatcc
ccgtattacccactatcgcctggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcaaccagtgtacccaatcacgacaggaggattcagacacccctac
cccacagctctgaccgtcaatgcttccatgtccagctttctgtcttctaggttccctccc
catatggtcccaccacatcatacgctacacacgacgggcattccgcatccggccatagtc
acaccaacagtcaaacaggaatcgtcccagagtgacgtcggctcactccatagctcaaag
catcaggactccaaaaaggaagaagaaaagaagaagccccacataaagaaacctcttaat
gcattcatgttgtatatgaaggaaatgagagcaaaggtcgtagctgagtgcacgttgaaa
gaaagcgcggccatcaaccagatccttgggcggaggtggcatgcactgtccagagaagag
caagcgaaatactacgagctggcccggaaggagcgacagcttcatatgcaactgtacccc
ggctggtccgcgcgggataactatggaaagaagaagaagaggaaaagggacaagcagccg
ggagagaccaatgaacacagcgaatgtttcctaaatccttgcctttcacttcctccgatt
acagacctgagcgctcctaagaaatgccgagcgcgctttggccttgatcaacagaataac
tggtgcggcccttgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagc
tgcctcagcccaccctcttcagatggaagcttactagattcgcctcccccctcccccaac
ctgctaggctcccctccccgagacgccaagtcacagactgagcagacccagcctctgtcg
ctgtccctgaagcccgaccccctggcccacctgtccatgatgcctccgccacccgccctc
ctgctcgccgaggccacccacaaggcctccgccctctgtcccaacggggccctggacctg
cccccagccgctttgcagcctgccgccccctcctcatcaattgcacagccgtcgacttct
tccttacattcccacagctccctggccgggacccagccccagccgctgtcgctcgtcacc
aagtctttagaatag

KEGG   Pongo abelii (Sumatran orangutan): 100436197
Entry
100436197         CDS       T01416                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05132  Salmonella infection
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100436197 (TCF7L1)
   04390 Hippo signaling pathway
    100436197 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100436197 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100436197 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436197 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100436197 (TCF7L1)
   05225 Hepatocellular carcinoma
    100436197 (TCF7L1)
   05226 Gastric cancer
    100436197 (TCF7L1)
   05216 Thyroid cancer
    100436197 (TCF7L1)
   05221 Acute myeloid leukemia
    100436197 (TCF7L1)
   05217 Basal cell carcinoma
    100436197 (TCF7L1)
   05215 Prostate cancer
    100436197 (TCF7L1)
   05213 Endometrial cancer
    100436197 (TCF7L1)
   05224 Breast cancer
    100436197 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100436197 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100436197 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100436197 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100436197 (TCF7L1)
   05165 Human papillomavirus infection
    100436197 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100436197 (TCF7L1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100436197 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100436197
NCBI-ProteinID: XP_024097989
LinkDB
Position
2A
AA seq 587 aa
MPQLGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRD
LDEVKSSLVNESENQSSSSDSEAERRPQPARDTFQKPRDYFAEVRRPQDSAFFKGPPYPG
YPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPV
VQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAV
GQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLP
TSGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMR
AKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGK
KKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPAT
PSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPPL
LSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcgggggcggcggtggcggcggcagcgggggaggcggcggctcc
agcgccggggcggccggcggaggggacgacctcggggcgaacgacgagctgatccccttc
caggacgaggggggcgaggagcaggagccgagcagcgacagcgcctcggcgcagcgggac
ctagacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcggac
tcggaggcggagaggcgcccgcagcccgcccgggacactttccagaagccgcgggactat
ttcgccgaagtgagaaggccccaggacagcgcgttctttaaaggacccccctaccctggg
taccccttcctgatgatcccggacctgagcagcccgtacctctccaacggacccctgtct
cccggaggagcgcgcacatacctgcagatgaaatggcccctcctcgatgtcccctccagc
gccacagtcaaggacacgaggtcaccatctccagcacacttgtctaataaagttcctgtc
gttcagcacccgcatcacatgcatccgctgactcccctcatcacctacagcaatgaccac
ttctcccccggctcccctcccacccacctctccccagagatcgatccaaagacaggaatc
ccccggccccctcacccatccgagctgtcaccgtattacccactctctcccggagctgtc
ggacaaatcccccaccccctcggctggctcgtcccacagcaaggccagcccatgtattcc
cttcctcctggtggctttcggcacccttaccctgccctcgccatgaacgcctcgatgtcc
agcctggtctccagtcggttctctcctcacatggtagctcccgcccaccctggcctgccc
acctcagggatcccccaccctgccatcgtctcccccatcgtcaagcaggaaccggcaccc
cccagcctgagccctgcagtaagcgcgaaatcaccagtcaccgtgaaaaaggaggaagaa
aagaagccccatgtgaagaagcctctgaatgccttcatgttgtatatgaaggagatgagg
gccaaggtggtggctgagtgcaccctgaaggaaagcgcagccattaaccagatcctggga
agaaagtggcacaacctgtctcgagaagaacaggccaagtactacgagctggcccggaag
gagcggcagcttcactcgcagctctacccaacctggtcagcccgggacaactatggtaag
aaaaagaagaggaagagagaaaagcagctgtcccagacacagtcacagcagcaagtccag
gaggcagagggtgccctggcctccaagagcaagaagccatgtgttcagtacctgcccccc
gagaagccctgtgacagccctgcctcctcccacgggagcatgctggactccccggccact
ccctctgcagctttggcctcaccagctgcccctgctgccacccattcggagcaagcccag
cccctctccctcaccaccaaaccagaaacccgggcccagctggctctccactctgccgcc
ttcctgtcagctaaggctgcagcctcctcctctgggcagatgggcagccagcctcccctc
ctgtcccggcccctcccccttgggtccatgcccacagctctgctggcctctcccccatcc
ttccccgccacgctccatgcccaccaggccctcccggtgctacaggcccagcctctttcc
ctggtcaccaagtctgcccactaa

KEGG   Pongo abelii (Sumatran orangutan): 100447785
Entry
100447785         CDS       T01416                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X2
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05132  Salmonella infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100447785 (LEF1)
   04390 Hippo signaling pathway
    100447785 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100447785 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100447785 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447785 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100447785 (LEF1)
   05225 Hepatocellular carcinoma
    100447785 (LEF1)
   05226 Gastric cancer
    100447785 (LEF1)
   05216 Thyroid cancer
    100447785 (LEF1)
   05221 Acute myeloid leukemia
    100447785 (LEF1)
   05217 Basal cell carcinoma
    100447785 (LEF1)
   05215 Prostate cancer
    100447785 (LEF1)
   05213 Endometrial cancer
    100447785 (LEF1)
   05224 Breast cancer
    100447785 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100447785 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100447785 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100447785 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100447785 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100447785 (LEF1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100447785 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100447785
NCBI-ProteinID: XP_002815091
Ensembl: ENSPPYG00000014987
UniProt: A0A2J8XQB3
LinkDB
Position
4
AA seq 386 aa
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWFSHHMIPGPPGPHTTGIPHPAIVTPQV
KQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAA
INQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTS
GGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgccccaactctccggaggaggtggcggcggcgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatcctcagaaggaaaagatcttcgccgag
atcagtcatcccgaagaggaaggcgatttagctgacatcaagtcttccttggtgaacgag
tctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctctcag
gagccctaccacgacaaggccagagaacaccccgatgacggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgagttattccgggtacataatgatgccaaatatg
aataatgacccatatatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgatatccctactttttatcccttgtct
ccgggtggtgttggacagatcaccccacctcttggctggttttcccatcatatgattccc
ggtcctcctggtccccacacaactggcatccctcatccagctattgtaacacctcaggtc
aaacaggaacatccccacactgacagtgacctaatgcacgtgaagcctcagcatgaacag
agaaaggagcaggagccaaaaagacctcacattaagaagcctctgaatgcttttatgtta
tacatgaaagaaatgagagcgaatgtcgttgctgagtgtactctaaaagaaagtgcagct
atcaaccagattctcggcagaaggtggcatgccctctcccgtgaagagcaggctaaatat
tatgaattagcacggaaagaaagacagctacatatgcagctttatccaggctggtctgca
agagacaattatggtaagaaaaagaagaggaagagagagaaactacaggaatctacatca
ggtggaaaacgaagctcattcccaacgtgcaaagccaaggcagcgaccccaggacctctt
ctggagatggaagcttgttga

KEGG   Pongo abelii (Sumatran orangutan): 100461234
Entry
100461234         CDS       T01416                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05132  Salmonella infection
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100461234 (TCF7)
   04390 Hippo signaling pathway
    100461234 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100461234 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    100461234 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100461234 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461234 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100461234 (TCF7)
   05225 Hepatocellular carcinoma
    100461234 (TCF7)
   05226 Gastric cancer
    100461234 (TCF7)
   05216 Thyroid cancer
    100461234 (TCF7)
   05221 Acute myeloid leukemia
    100461234 (TCF7)
   05217 Basal cell carcinoma
    100461234 (TCF7)
   05215 Prostate cancer
    100461234 (TCF7)
   05213 Endometrial cancer
    100461234 (TCF7)
   05224 Breast cancer
    100461234 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100461234 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100461234 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100461234 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100461234 (TCF7)
   05165 Human papillomavirus infection
    100461234 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100461234 (TCF7)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100461234 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 Peptidase_M13
Other DBs
NCBI-GeneID: 100461234
NCBI-ProteinID: XP_024102802
LinkDB
Position
5
AA seq 429 aa
MPQLDSGGGGAGGGGDDLGAPDELLAFQDEGEEQDDKNRDIAAGPERDLAELKSSLVNES
EGAAGGAGIPGVPGAGAGARSEAEVRAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSG
MYKETVYSAFNLLMHYPPASGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAP
ADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTA
APGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEA
KKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARK
ERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTDPGSPKKCRARFGLNQQTDWCGPCRD
KLAQRTQGW
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgccgcagctggactccggcgggggcggcgcgggcggcggcggcgacgacctcggcgcg
ccggacgagctgctggccttccaggatgagggcgaggagcaggacgacaagaaccgcgac
attgccgccggtcccgagcgcgacctggccgagctcaagtcgtcgctcgtgaacgagtcc
gagggcgcggccggcggcgcagggatcccgggggtcccaggggcaggcgccggggcccgc
agcgaggccgaggtccgggccgaggctctcgggcgggaacacgctgcgcagagactcttc
ccggacaaacttccagagcccctggaggacggcctgaaggccccggagtgcaccagcggc
atgtacaaagagaccgtctactccgccttcaatctgctcatgcactacccacccgcctcg
ggagcagggcagcacccccagccgcagcccccgctgcacaaggccaatcagcccccccac
ggtgtcccccaactctctctctacgaacatttcaacagcccacatcccacccctgcacct
gcggacatcagccagaagcaagttcacaggcctctacagacccctgacctctctggcttc
tactccctgacctcaggcagcatggggcagctcccccacactgtgagctggcccagccct
cctctctaccccctgtccccttcctgcggatatagacagcacttccctgcccccactgca
gcccctggcgccccctaccccaggttcacccacccatccttgatgctaggttctggtgta
cctggtcacccagcagccatcccccacccggcaattgtgcccccctcagggaagcaggag
ctgcagcccttcgaccgcaacctgaagacacaagcagagtccaaggcagagaaggaggcg
aagaagccaaccatcaagaagcccctcaatgccttcatgctgtacatgaaggagatgaga
gccaaggtcattgcagagtgcacacttaaggagagcgctgccatcaaccagatcctgggc
cgcaggtggcacgcgctgtcgcgagaagagcaggccaagtactatgagctggcccgcaag
gagaggcagctgcacatgcagctatacccaggctggtcggcgcgggacaactacgggaag
aagaagaggcggtcgagggaaaagcaccaagaatccaccacagaccctggctcgcctaag
aaatgccgtgctcgctttggcctcaaccagcagacggattggtgtggtccgtgcagagac
aaactggcccagagaactcaaggatggtaa

DBGET integrated database retrieval system