KEGG   Pongo abelii (Sumatran orangutan): 100435111
Entry
100435111         CDS       T01416                                 

Gene name
PCYT1A
Definition
(RefSeq) choline-phosphate cytidylyltransferase A
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00440  Phosphonate and phosphinate metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon05231  Choline metabolism in cancer
Module
pon_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100435111 (PCYT1A)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    100435111 (PCYT1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100435111 (PCYT1A)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     100435111 (PCYT1A)
SSDB
Motif
Pfam: CTP_transf_like hNIFK_binding DUF1664 YtxH
Other DBs
NCBI-GeneID: 100435111
NCBI-ProteinID: XP_002814491
Ensembl: ENSPPYG00000014437
UniProt: A0A6D2VZ73 A0A2J8RGD2
LinkDB
Position
3
AA seq 367 aa
MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYV
RVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHN
FKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKY
HLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGALK
HMLKEGKGRMLQAISPKQSPSSSPTHERSPSPSFRWPFSGKTSPPCSPANLSRHKAAAYD
ISEDEED
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggatgcacagtgttcagccaaggtcaatgcaaggaagaggagaaaagaggcgcccgga
cccaacggggcaacagaggaagatggggttccttccaaagtgcagcgctgtgcagtgggc
ttacggcaaccagctcctttttctgatgaaattgaagttgactttagtaagccctatgtc
agggtaactatggaagaagccagcagaggaactccttgtgagcgacctgtgagagtttat
gctgatggaatatttgacttatttcactctggtcacgcccgagctctgatgcaagcaaag
aaccttttccctaatacatacctcattgtgggagtttgcagtgatgagctcacacacaac
ttcaaaggcttcacggtgatgaacgagaatgagcgctatgacgcagtccagcactgccgc
tacgtggatgaggtggtgaggaatgcgccctggacgctgacacccgagttcctggccgaa
caccggattgattttgtagcccatgatgatattccttattcatctgctggaagtgatgat
gtttataagcacatcaaggaggcaggcatgtttgctccaacacagaggacagaaggtatc
tccacatcagacatcatcacccgaattgtgcgggattatgatgtgtatgcgaggcggaac
ctgcagaggggctacacagcaaaggagctcaatgtcagctttatcaacgagaagaaatac
cacttgcaggagagggttgacaaagtaaagaagaaagtgaaagatgtggaggaaaagtca
aaagaatttgttcagaaggtggaggagaaaagcatcgacctcattcagaagtgggaggag
aagtcccgagaattcattggaagttttctggaaatgtttggtccggaaggagcactgaaa
catatgctgaaagaggggaagggccggatgctgcaggccatcagcccgaagcaaagcccc
agcagcagccctactcacgagcgctccccctccccctctttccgatggcccttctcgggc
aagacttccccaccttgctccccagcaaatctctccaggcacaaggctgcagcctatgat
atcagtgaggatgaagaagactaa

KEGG   Pongo abelii (Sumatran orangutan): 100462209
Entry
100462209         CDS       T01416                                 

Gene name
PCYT1B
Definition
(RefSeq) choline-phosphate cytidylyltransferase B isoform X1
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00440  Phosphonate and phosphinate metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon05231  Choline metabolism in cancer
Module
pon_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100462209 (PCYT1B)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    100462209 (PCYT1B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100462209 (PCYT1B)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     100462209 (PCYT1B)
SSDB
Motif
Pfam: CTP_transf_like Lipoprotein_6 YtxH
Other DBs
NCBI-GeneID: 100462209
NCBI-ProteinID: XP_024096486
LinkDB
Position
X
AA seq 369 aa
MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHE
KLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHK
FKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRY
RFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWK
QMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISS
MSEGDEDEK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccagtagttaccactgatgctgagtcagaaacaggtatcccaaaatccctttccaat
gagcctccctcagaaaccatggaggaaatagagcacacatgcccacagcctcgactgacc
ctgactgcacctgccccatttgctgatgaaaccaactgccagtgtcaagcaccccatgaa
aaactgaccattgctcaggcccgcttaggaacaccagctgacaggcctgtcagagtatac
gccgatggaatatttgacctcttccactcaggtcacgcaagagcccttatgcaagcaaaa
acactgtttcccaacagctacttgttggtaggagtttgcagtgatgatctcacccacaaa
ttcaaaggtttcaccgtgatgaatgaagctgagagatacgaagctctcagacactgtcgc
tacgtagacgaagttatcagagatgctccctggacactcacgccagagtttctggaaaaa
cacaagattgactttgtggctcatgatgacattccgtattcctctgctggctctgatgat
gtttacaagcacataaaggaagcagggatgttcgttccaacacagagaacagaaggcatc
tcaacatcggacatcattaccagaattgttcgtgactatgatgtttatgcccgacgtaac
ctccagagagggtatacagccaaggaactgaatgtcagctttataaatgagaagaggtac
cgtttccagaaccaagtggacaaaatgaaggaaaaagtcaagaatgtggaggaaagatca
aaggaatttgtgaacagagtggaagaaaagagccatgatctaattcaaaagtgggaagag
aagtcaagggaattcattggcaacttcctagaactgtttggacctgatggagcatggaag
cagatgttccaggagaggagcagccggatgctgcaggccttatccccgaagcagagccct
gtgagcagcccaacccggagccggtccccttcccgctccccatcgcccaccttctcatgg
cttccactcaaaacctcacccccttcctcacccaaagcagcctcagcctctatcagcagc
atgagcgagggggatgaggatgaaaagtag

DBGET integrated database retrieval system