KEGG   Pongo abelii (Sumatran orangutan): 100435218
Entry
100435218         CDS       T01416                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04010  MAPK signaling pathway
pon04071  Sphingolipid signaling pathway
pon04110  Cell cycle
pon04115  p53 signaling pathway
pon04137  Mitophagy - animal
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04216  Ferroptosis
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04722  Neurotrophin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100435218 (TP53)
   04310 Wnt signaling pathway
    100435218 (TP53)
   04071 Sphingolipid signaling pathway
    100435218 (TP53)
   04151 PI3K-Akt signaling pathway
    100435218 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100435218 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    100435218 (TP53)
   04210 Apoptosis
    100435218 (TP53)
   04216 Ferroptosis
    100435218 (TP53)
   04115 p53 signaling pathway
    100435218 (TP53)
   04218 Cellular senescence
    100435218 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100435218 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100435218 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    100435218 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100435218 (TP53)
   05202 Transcriptional misregulation in cancer
    100435218 (TP53)
   05206 MicroRNAs in cancer
    100435218 (TP53)
   05205 Proteoglycans in cancer
    100435218 (TP53)
   05203 Viral carcinogenesis
    100435218 (TP53)
   05230 Central carbon metabolism in cancer
    100435218 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100435218 (TP53)
   05212 Pancreatic cancer
    100435218 (TP53)
   05225 Hepatocellular carcinoma
    100435218 (TP53)
   05226 Gastric cancer
    100435218 (TP53)
   05214 Glioma
    100435218 (TP53)
   05216 Thyroid cancer
    100435218 (TP53)
   05220 Chronic myeloid leukemia
    100435218 (TP53)
   05217 Basal cell carcinoma
    100435218 (TP53)
   05218 Melanoma
    100435218 (TP53)
   05219 Bladder cancer
    100435218 (TP53)
   05215 Prostate cancer
    100435218 (TP53)
   05213 Endometrial cancer
    100435218 (TP53)
   05224 Breast cancer
    100435218 (TP53)
   05222 Small cell lung cancer
    100435218 (TP53)
   05223 Non-small cell lung cancer
    100435218 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100435218 (TP53)
   05014 Amyotrophic lateral sclerosis
    100435218 (TP53)
   05016 Huntington disease
    100435218 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100435218 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100435218 (TP53)
   05161 Hepatitis B
    100435218 (TP53)
   05160 Hepatitis C
    100435218 (TP53)
   05162 Measles
    100435218 (TP53)
   05168 Herpes simplex virus 1 infection
    100435218 (TP53)
   05163 Human cytomegalovirus infection
    100435218 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100435218 (TP53)
   05169 Epstein-Barr virus infection
    100435218 (TP53)
   05165 Human papillomavirus infection
    100435218 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100435218 (TP53)
   01522 Endocrine resistance
    100435218 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100435218 (TP53)
   03036 Chromosome and associated proteins [BR:pon03036]
    100435218 (TP53)
   03400 DNA repair and recombination proteins [BR:pon03400]
    100435218 (TP53)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100435218 (TP53)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100435218 (TP53)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100435218 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer TAD2 P53_TAD
Other DBs
NCBI-GeneID: 100435218
NCBI-ProteinID: XP_002827020
Ensembl: ENSPPYG00000007934
UniProt: H2NSL2
LinkDB
Position
17
AA seq 393 aa
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLLLSPDDIAQWFIEDPGP
DEAPRMSEAASPVDPAPAAPIPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK
SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPHHELP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaggagccacagtcagatcctagcgtcgagcccccactgagccaggaaacattttca
gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcggtg
gatgatttgctgctgtccccggacgatattgcacaatggttcattgaagacccaggtcca
gatgaagctcccagaatgtcagaggctgcttcccctgtggaccccgcaccagcagctcct
ataccggcggcccctgcaccagccccctcctggcccctgtcatcctctgtcccttcccag
aaaacctaccagggcagctacggtttccgtctgggcttcttgcattctgggacagccaag
tctgtgacttgcacgtactcccctgccctcaacaagatgttttgccagctggccaagacc
tgccctgtgcagctgtgggttgattccacacccccacctggcacccgcgtccgcgccatg
gccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgtccccaccatgag
cgctgctcagatagtgatggtctggcccctcctcagcatcttatccgagtggaaggaaat
ttgcgtgtggagtatttggatgacagaaacacttttcgacatagtgtggtggtgccctat
gagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagt
tcctgcatgggcggcatgaaccggaggcccatcctcaccatcatcacactggaagactcc
agtggtaatctactgggacggaacagctttgaggtgcgcgtttgtgcctgtcctgggaga
gaccggcgcacagaggaagagaatttccgcaagaaaggggagcctcaccatgagctgccc
cctgggagcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaag
aaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatg
ttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaggagccaggg
gggagcagggctcactccagccacctgaagtccaagaagggtcagtctacctcccgccat
aaaaaactcatgttcaagacagaagggcctgactcagactga

DBGET integrated database retrieval system