Pongo abelii (Sumatran orangutan): 100435218 Help Entry 100435218         CDS       T01416                                  Gene name TP53 Definition (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon01522   Endocrine resistance pon01524   Platinum drug resistance pon04010   MAPK signaling pathway pon04071   Sphingolipid signaling pathway pon04110   Cell cycle pon04115   p53 signaling pathway pon04137   Mitophagy - animal pon04151   PI3K-Akt signaling pathway pon04210   Apoptosis pon04211   Longevity regulating pathway pon04216   Ferroptosis pon04218   Cellular senescence pon04310   Wnt signaling pathway pon04722   Neurotrophin signaling pathway pon04919   Thyroid hormone signaling pathway pon05012   Parkinson disease pon05014   Amyotrophic lateral sclerosis pon05016   Huntington disease pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05165   Human papillomavirus infection pon05166   Human T-cell leukemia virus 1 infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05200   Pathways in cancer pon05202   Transcriptional misregulation in cancer pon05203   Viral carcinogenesis pon05205   Proteoglycans in cancer pon05206   MicroRNAs in cancer pon05210   Colorectal cancer pon05212   Pancreatic cancer pon05213   Endometrial cancer pon05214   Glioma pon05215   Prostate cancer pon05216   Thyroid cancer pon05217   Basal cell carcinoma pon05218   Melanoma pon05219   Bladder cancer pon05220   Chronic myeloid leukemia pon05222   Small cell lung cancer pon05223   Non-small cell lung cancer pon05224   Breast cancer pon05225   Hepatocellular carcinoma pon05226   Gastric cancer pon05230   Central carbon metabolism in cancer pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100435218 (TP53)    04310 Wnt signaling pathway     100435218 (TP53)    04071 Sphingolipid signaling pathway     100435218 (TP53)    04151 PI3K-Akt signaling pathway     100435218 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100435218 (TP53)   09143 Cell growth and death    04110 Cell cycle     100435218 (TP53)    04210 Apoptosis     100435218 (TP53)    04216 Ferroptosis     100435218 (TP53)    04115 p53 signaling pathway     100435218 (TP53)    04218 Cellular senescence     100435218 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     100435218 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     100435218 (TP53)   09149 Aging    04211 Longevity regulating pathway     100435218 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100435218 (TP53)    05202 Transcriptional misregulation in cancer     100435218 (TP53)    05206 MicroRNAs in cancer     100435218 (TP53)    05205 Proteoglycans in cancer     100435218 (TP53)    05203 Viral carcinogenesis     100435218 (TP53)    05230 Central carbon metabolism in cancer     100435218 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     100435218 (TP53)    05212 Pancreatic cancer     100435218 (TP53)    05225 Hepatocellular carcinoma     100435218 (TP53)    05226 Gastric cancer     100435218 (TP53)    05214 Glioma     100435218 (TP53)    05216 Thyroid cancer     100435218 (TP53)    05220 Chronic myeloid leukemia     100435218 (TP53)    05217 Basal cell carcinoma     100435218 (TP53)    05218 Melanoma     100435218 (TP53)    05219 Bladder cancer     100435218 (TP53)    05215 Prostate cancer     100435218 (TP53)    05213 Endometrial cancer     100435218 (TP53)    05224 Breast cancer     100435218 (TP53)    05222 Small cell lung cancer     100435218 (TP53)    05223 Non-small cell lung cancer     100435218 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     100435218 (TP53)    05014 Amyotrophic lateral sclerosis     100435218 (TP53)    05016 Huntington disease     100435218 (TP53)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100435218 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100435218 (TP53)    05161 Hepatitis B     100435218 (TP53)    05160 Hepatitis C     100435218 (TP53)    05162 Measles     100435218 (TP53)    05168 Herpes simplex virus 1 infection     100435218 (TP53)    05163 Human cytomegalovirus infection     100435218 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     100435218 (TP53)    05169 Epstein-Barr virus infection     100435218 (TP53)    05165 Human papillomavirus infection     100435218 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100435218 (TP53)    01522 Endocrine resistance     100435218 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pon03000]     100435218 (TP53)    03036 Chromosome and associated proteins [BR:pon03036]     100435218 (TP53)    03400 DNA repair and recombination proteins [BR:pon03400]     100435218 (TP53) Transcription factors [BR:pon03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     100435218 (TP53) Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      100435218 (TP53) DNA repair and recombination proteins [BR:pon03400]  Eukaryotic type   Check point factors    Other check point factors     100435218 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer TAD2 P53_TAD Motif Other DBs NCBI-GeneID:  100435218 NCBI-ProteinID:  XP_002827020 Ensembl:  ENSPPYG00000007934 UniProt:  H2NSL2 LinkDB All DBs Position 17 AA seq 393 aa AA seqDB search MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLLLSPDDIAQWFIEDPGP DEAPRMSEAASPVDPAPAAPIPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPHHELP PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt atggaggagccacagtcagatcctagcgtcgagcccccactgagccaggaaacattttca gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcggtg gatgatttgctgctgtccccggacgatattgcacaatggttcattgaagacccaggtcca gatgaagctcccagaatgtcagaggctgcttcccctgtggaccccgcaccagcagctcct ataccggcggcccctgcaccagccccctcctggcccctgtcatcctctgtcccttcccag aaaacctaccagggcagctacggtttccgtctgggcttcttgcattctgggacagccaag tctgtgacttgcacgtactcccctgccctcaacaagatgttttgccagctggccaagacc tgccctgtgcagctgtgggttgattccacacccccacctggcacccgcgtccgcgccatg gccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgtccccaccatgag cgctgctcagatagtgatggtctggcccctcctcagcatcttatccgagtggaaggaaat ttgcgtgtggagtatttggatgacagaaacacttttcgacatagtgtggtggtgccctat gagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagt tcctgcatgggcggcatgaaccggaggcccatcctcaccatcatcacactggaagactcc agtggtaatctactgggacggaacagctttgaggtgcgcgtttgtgcctgtcctgggaga gaccggcgcacagaggaagagaatttccgcaagaaaggggagcctcaccatgagctgccc cctgggagcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaag aaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatg ttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaggagccaggg gggagcagggctcactccagccacctgaagtccaagaagggtcagtctacctcccgccat aaaaaactcatgttcaagacagaagggcctgactcagactga

DBGET integrated database retrieval system