KEGG   Pongo abelii (Sumatran orangutan): 100435715
Entry
100435715         CDS       T01416                                 

Gene name
STMN1
Definition
(RefSeq) stathmin
  KO
K04381  stathmin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100435715 (STMN1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100435715 (STMN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100435715 (STMN1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Stathmin
     100435715 (STMN1)
SSDB
Motif
Pfam: Stathmin Ribonuc_2-5A
Other DBs
NCBI-GeneID: 100435715
NCBI-ProteinID: XP_003775816
Ensembl: ENSPPYG00000001700
UniProt: A0A6D2VTU0 A0A2J8SIM3
LinkDB
Position
1
AA seq 149 aa
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHIEEVRKNKESKDPADETEAD
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcttcttctgatatccaggtgaaagaactggagaagcgtgcctcaggccaggctttt
gagctgattctcagccctcggtcaaaagaatctgttccagaattccccctttcgcctcca
aagaagaaggatctttccctggaggaaattcagaagaaattagaagctgcagaagaaaga
cgcaagtcccatgaagctgaggtcttgaagcagctggctgagaaacgagagcacgagaaa
gaagtgcttcagaaggcaatagaagagaacaacaacttcagtaaaatggcagaagagaaa
ctgacccacaaaatggaagctaataaagagaaccgagaggcacaaatggctgccaaactg
gagcgtttgcgagagaaggataagcacattgaagaagtgcggaagaacaaagaatccaaa
gaccctgctgacgagactgaagctgactaa

DBGET integrated database retrieval system