KEGG   Pongo abelii (Sumatran orangutan): 100435972
Entry
100435972         CDS       T01416                                 

Gene name
SLC7A9
Definition
(RefSeq) B(0,+)-type amino acid transporter 1
  KO
K13868  solute carrier family 7 (L-type amino acid transporter), member 9/15
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100435972 (SLC7A9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100435972 (SLC7A9)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100435972 (SLC7A9)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 100435972
NCBI-ProteinID: XP_002829067
Ensembl: ENSPPYG00000009822
UniProt: A0A6D2WSB5 A0A2J8RL39
LinkDB
Position
19
AA seq 487 aa
MGDTGLRKRREDEKSMQSQEPKTTNLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTE
AVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYLMEAYGPIPAYLFSWASLIVI
KPSSFAIICLSFSEYVCAPFYAGCKPPQIVVKCLAAAAILFISTVNSLSVRLGSYVQNFF
TAAKLVIVAIIIISGLVLLAQGNTKNFDNSFEGAQLSVGAISLAFYNGLWAYDGWNQLNY
ITEELRNPYRNLPLAIIIGIPLVTACYILMNVSYFTVMTATELLQSQAVAVTFGDRVLYP
ASWIVPLFVAFSTIGAANGTCFTAGRLIYVAGREGHMLKVLSYISVRRLTPAPAIIFYGI
IATIYIIPGDINSLVNYFSFAAWLFYGLTILGLIVMRFTRKELERPIKVPIVIPVLVTLI
SVFLVLAPIISKPAWEYLYCMLFILSGVLFYFLFVHYKFGWAQKISKPITMHLQMLMEVV
PPEEDPE
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgggggatactggcctgagaaagcggagagaggatgagaagtcgatgcagagccaagag
cctaagaccaccaatctccaaaaggagctgggcctcatcagtggcatctccatcatcgtg
ggcaccatcattggctctgggatcttcgtttcccccaagtctgtgctcagcaacacggaa
gctgtggggccctgcctcatcatatgggcggcttgcggggtcctcgcgacgctgggcgcc
ctgtgctttgcggagcttggcacaatgatcaccaagtcaggtggtgagtatccttacctg
atggaggcctacgggcccatccccgcctacctcttctcctgggccagcctgatcgtcatc
aagccctcatccttcgccatcatctgcctcagcttctccgagtatgtgtgcgcgcccttc
tatgcgggctgcaagcctcctcaaatcgttgtgaaatgcctggccgccgccgccatcttg
ttcatctcgacggtgaactcactgagcgtgcggctgggaagctacgtccagaacttcttc
actgcagccaagctggtgatcgtggccatcatcatcatcagcgggctcgtgctcctggcc
caaggaaacacaaagaattttgataattctttcgagggcgcccagctgtctgtgggagcc
atcagcctggcgttttacaatggactctgggcctatgatggatggaatcaactcaattac
atcacagaagaacttagaaacccttacagaaacctgcctttggccattatcattgggatc
cccctggtgacggcatgctacatcctcatgaacgtgtcctacttcaccgtgatgactgcc
accgaactcctgcagtcccaggccgtggctgtgacatttggtgaccgtgttctctatcct
gcttcttggatcgttccactttttgtggcattttcaaccatcggtgctgctaacgggacc
tgcttcacagcgggcagactcatttacgtggcgggccgggagggccacatgctcaaagtg
ctttcttacatcagcgtcaggcgcctcactccagcccccgccatcatcttttatggtatc
atagcaacgatttatatcatccctggtgacataaactcgttagtcaattatttcagcttt
gccgcatggctgttttatggcctgacgattctaggactcatcgtgatgagatttacaagg
aaagagctggaaaggcctatcaaggtgcccatagtcattcccgtcttggtgacactcatc
tctgtgtttttggttctggctccaatcatcagcaagcccgcatgggagtacctctactgt
atgctgtttatattaagcggcgttttattttacttcctgtttgtccactacaagtttgga
tgggctcagaaaatctcaaagccgattaccatgcaccttcagatgctaatggaagtggtc
ccaccagaggaagaccctgagtaa

DBGET integrated database retrieval system