KEGG   Pongo abelii (Sumatran orangutan): 100436112
Entry
100436112         CDS       T01416                                 

Gene name
DLL3
Definition
(RefSeq) delta-like protein 3 isoform X2
  KO
K06051  delta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04330  Notch signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon05200  Pathways in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100436112 (DLL3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100436112 (DLL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436112 (DLL3)
  09162 Cancer: specific types
   05224 Breast cancer
    100436112 (DLL3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100436112 (DLL3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 DSL EGF_CA
Other DBs
NCBI-GeneID: 100436112
NCBI-ProteinID: XP_002829255
LinkDB
Position
19
AA seq 587 aa
MVSPRMSRLLSQTVILALIFLPQARPAGVFELQINSFGPGPGPGAPRSPCRVRVPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
SLIIETWREELGDQIGGPAWSLLARVAGRRRLAAGDPWARDIQRAGAWELRFSYRARCEP
PAVGTACMRLCRPRSAPSRCGPGLRPCAPLQDECQAPPVCRAGCSPEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTRCLVPGPGPCDGNPCANGGSCSETPGSFECAC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHAQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGPGDGPSSSVDWNRPEDVDPRGIYVISAPSIYAREA
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggtctccccacggatgtcccggctcctctcccagactgtgatcctagcgctcattttc
ctcccccaggcacggcccgctggcgtcttcgagctgcagatcaactctttcgggccgggt
ccaggccctggggccccgcggtccccctgcagggtccgggtcccctgccgcctcttcttc
agagtctgcctgaagcctgggctctcggaggaggccgccgagtccccgtgcgccctgggc
gcggcactgagtgcgcgcggacccgtctacaccgagcagcccggagcgcccgcgcctgat
ctcccactgcccgacggcctcttgcaggtgcccttccgggacgcctggcctggcaccttc
tctctcatcatcgaaacctggagagaggagttaggagaccagattggagggcccgcctgg
agcctgctggcgcgagtggctggccggcggcgcttggcagccggggacccgtgggcccgg
gacattcagcgcgcaggcgcctgggagctgcgcttctcgtaccgcgcgcgctgcgagccg
cctgcagtcgggaccgcgtgcatgcgcctctgccgtccgcgcagcgccccctcgcggtgt
ggcccgggactgcgcccctgcgcaccgctccaggacgagtgccaggcgccgccggtgtgc
cgagcaggctgcagccccgagcatggcttctgtgaacagcctggtgaatgccgatgccta
gagggctggactggacccctctgcacggtccctgtctccaccagcagctgcctcagcccc
aggggcccatcctctgctactaccagatgccttgtccctgggcctgggccttgtgacggg
aacccgtgtgccaatggaggcagctgtagtgagacacccgggtcctttgaatgcgcctgc
ccgcgtgggttctacgggctgcggtgtgaggtgagcggggtgacatgtgcggatggaccc
tgcttcaacggcggcttgtgtgtcgggggtgcagaccctgactctgcctacatctgccac
tgcccacccggtttccaaggctccaactgtgagaagagggtggaccggtgcagcctgcag
ccatgccgcaatggcggactctgcctggacctgggccacgccctgcgctgccgctgccgc
gccggcttcgcgggtccgcgctgcgagcacgacctggacgactgcgcgggccgcgcctgc
gctaacggcggcacgtgtgtggagggcggcggcgcgcaccgctgctcctgcgcgctgggc
ttcggcggccgcgactgccgcgagcgcgcggacccgtgcgccgcgcgcccctgtgctcac
ggcggccgctgctacgcccacttctccggcctcgtttgcgcctgcgcgcccggctatatg
ggagcgcggtgtgagttcccagtgcaccccgacggcgcaagcgcgttgcccgcggccccg
ccgggcctgaggcccggggacccgcagcgctaccttttgccgccggctctgggactgctg
gtggccgcgggcgtggccggcgctgcgctcttgctggtccacgtgcgccgccgtggccac
gcccaggatgctgggtctcgcttgctggctgggaccccggagccgtcagtccacgcactc
ccggatgcactcaacaacctaaggacgcaggagggtcccggggatggcccgagctcgtcc
gtagattggaatcgccctgaagatgtagaccctcgagggatttatgtcatatctgctcct
tccatctacgctcgggaggcctga

KEGG   Pongo abelii (Sumatran orangutan): 100436254
Entry
100436254         CDS       T01416                                 

Gene name
DLL1
Definition
(RefSeq) delta-like protein 1
  KO
K06051  delta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04330  Notch signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon05200  Pathways in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100436254 (DLL1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100436254 (DLL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436254 (DLL1)
  09162 Cancer: specific types
   05224 Breast cancer
    100436254 (DLL1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100436254 (DLL1)
SSDB
Motif
Pfam: EGF MNNL hEGF DSL EGF_2 EGF_3 EGF_CA ECSCR cEGF
Other DBs
NCBI-GeneID: 100436254
NCBI-ProteinID: XP_002817651
Ensembl: ENSPPYG00000017189
UniProt: A0A6D2XVJ2 A0A2J8SA08
LinkDB
Position
6
AA seq 723 aa
MGGRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSTVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
KICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFTCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKRRPPADPCRGEMETMNNLANCQREK
DISVSVIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLMQDLKGDDTAVRDAHSK
RDTKCQPQDSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIA
TEV
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgggcggtcggtgcgcgctggccctggcggtgctctcggccttgctgtgtcaggtctgg
agctctggggtgttcgagctgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggcgcggggccgccgccgtgcgcctgccggaccttcttc
cgcgtgtgcctcaagcactaccaggccagcgtgtcccccgagccgccctgcacctacggc
agcaccgtcacccccgtgctgggcgtcgactccttcagtctgcccgacggcgggggtgcg
gactccgcgttcagcaaccccatccgcttccccttcggcttcacctggccgggcaccttc
tctctgattattgaagctctccacacagattctcctgatgacctcgcaacagaaaaccca
gaaagactcatcagccgcctggccacccagaggcacctgacggtgggcgaggagtggtcc
caggacctgcacagcagcggccgcacggacctcaagtactcctaccgcttcgtgtgtgac
gaacactactacggagagggttgctccgttttctgtcgcccccgggacgatgccttcggc
cacttcacctgtggggagcgtggggagaaagtgtgcaaccctggctggaaagggccctac
tgcacagagcctatctgcctgcctggttgtgatgagcagcatggattttgtgacaaacca
ggggaatgcaagtgcagagtgggctggcagggccggtactgtgacgagtgtatccgctat
ccaggctgtctccatggcacctgccagcagccctggcagtgcaactgccaggaaggctgg
gggggccttttctgcaaccaggacctgaactactgcacacaccataagccctgcaagaat
ggggccacctgcaccaacacgggccaggggagctacacttgctcttgccggcctgggtac
acaggtgccacctgcgagctggggatcgacgagtgtgaccccagcccttgtaagaatgga
gggagctgcacggatctcgagaacagctactcctgtacctgcccacccggattctacggc
aaaatctgtgaattgagtgccatgacctgtgcggatggcccttgctttaacgggggccgg
tgctcagacagccccgatggagggtacagctgccgctgccccgtgggctattccggcttc
aactgtgagaagaaaattgactactgcagttcttcaccctgttctaatggtgccaagtgt
gtggacctcggtgatgcctacctgtgccgctgccaggccggcttctcggggaggcactgt
gacgacaacgtggacgactgcgcctcctccccgtgcgccaacgggggtacctgccgggac
ggcgtgaatgacttcacctgcacctgcccgcccggctacacgggcaggaactgcagtgcc
cccgtcagcaggtgcgagcacgcaccctgccacaatggggccacctgccacgagaggggc
caccgctatgtgtgcgagtgtgcccggggctacgggggtcccaactgccagttcctgctt
cccgagctgcccccgggcccagcggtggtggacctcactgagaagctagagggccagggc
gggccattcccctgggtggccgtgtgcgccggggtcatccttgtcctcatgctgctgctg
ggctgtgccgctgtggtggtctgcgtccggctgaggctgcagaagcgccggcccccagcc
gacccctgccggggggagatggagaccatgaacaacctggccaactgccagcgtgagaag
gacatctcagtcagcgtcattggggccacgcagatcaagaacaccaacaagaaggcggac
ttccacggggaccacagcgccgacaagaatggcttcaaggcccgctacccggcggtggac
tataacctcatgcaggacctcaagggtgacgacaccgccgtcagggacgcgcacagcaag
cgtgacaccaagtgccagccccaagactcctcaggggaggagaaggggaccccgaccaca
ctcaggggtggagaagcatctgaaagaaaaaggccggactcgggctgttcgacttcaaaa
gacaccaagtaccagtcggtgtacgtcatatccgaggagaaggatgagtgcgtcatagca
actgaggtgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100437589
Entry
100437589         CDS       T01416                                 

Gene name
DLL4
Definition
(RefSeq) delta-like protein 4
  KO
K06051  delta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04330  Notch signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon05200  Pathways in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100437589 (DLL4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100437589 (DLL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437589 (DLL4)
  09162 Cancer: specific types
   05224 Breast cancer
    100437589 (DLL4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100437589 (DLL4)
SSDB
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 EGF_3 DUF4381 EGF_CA Laminin_EGF
Other DBs
NCBI-GeneID: 100437589
NCBI-ProteinID: XP_002825364
Ensembl: ENSPPYG00000029409
UniProt: A0A663D7Z6 K7EVI9
LinkDB
Position
15
AA seq 685 aa
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGSVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGASYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFMGTYCERHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggcggcagcgtcccggagcgcctctggctgggcgctactgctgctggtggcactttgg
cagcagcgcgcggccggctccggcgtcttccagctgcagctgcaggagttcatcaacgag
cgcggcgtactggccagtgggcggccttgcgagcccggctgccggactttcttccgcgtc
tgccttaagcacttccaggcggtcgtctcgcccggaccctgcaccttcgggagcgtctcc
acgccggtattgggcaccaactccttcgctgtccgggacgacagtagcggcggggggcgc
aaccctctccaactgcccttcaatttcacctggccgggtaccttctcactcatcatcgaa
gcttggcacgcgccaggagacgacctgcggccagaggccttgccaccagatgcactcatc
agcaagatcgccatccagggctccctagctgtgggtcagaactggttattggatgagcaa
accagcaccctcacaaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggagacaactgctcccgcctgtgcaagaagcgcaatgaccacttcggccactatgtgtgc
cagccagatggcaacttgtcctgcctgcccggttggactggggaatactgccaacaacct
atctgtctttcgggctgtcatgaacagaatggctactgcagcaagccagcagagtgcctc
tgccgcccaggctggcagggccggctgtgtaacgaatgcatcccccacaatggctgtcgc
cacggcacctgcagcactccctggcaatgtacttgtgatgagggctggggaggcctgttt
tgtgaccaagatctcaactactgcacccaccactccccatgcaagaatggggcaacgtgc
tccaacagtgggcagcgaagctacacctgcacctgtcgcccaggctacactggtgtggac
tgtgagctggagctcagtgagtgtgacagcaacccctgtcgcaatggaggcagctgtaag
gaccaggaggatggctaccactgcctgtgtcctccgggctactatggcctgcattgtgaa
cacagcaccttgagctgcgccgactccccctgcttcaatgggggctcctgccgggaacgc
aaccagggggccagctatgcttgtgaatgtccccccaacttcactggctccaactgcgag
aagaaagtggacaggtgcaccagcaacccgtgtgccaacgggggacagtgcctgaaccga
ggtccaagccgcatgtgccgctgccgtcctggattcatgggcacctactgtgaacgccac
gtcagcgactgtgcccgtaacccttgtgcccacggtggcacttgccatgacctggagaat
gggctcatgtgcacctgccctgccggcttctctggccggcgctgtgaggtgcggacatcc
atcgatgcctgtgcctcgagtccctgcttcaacagggccacctgctacactgacctctcc
acagacaccttcgtgtgcaactgcccttatggctttgtgggcagccgctgcgagttcccc
gtgggcttgccgcccagcttcccctgggtggccgtttcgctgggcgtggggctggcagtg
ctgctggtactgctgggcatggtggcagtggctgtgcggcagctgcggcttcgacggcca
gacgacggcagcagggaggccatgaacaacttgtcggacttccagaaggacaacctgatt
cctgccgcccaacttaaaaacacaaaccagaagaaggagctggaagtggactgtggcctg
gacaagtccaactgtggcaaacagcaaaaccatacattggactataatctggccccaggg
cccctggggcgggggaccatgccaggaaagtttccccacagtgacaagagcttaggggag
aaggcgccactgcggttacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggactccatgtaccagtctgtgtgtttgatatcagaggagaggaacgaatgtgtc
attgccacggaggtataa

DBGET integrated database retrieval system