KEGG   Pongo abelii (Sumatran orangutan): 100436127
Entry
100436127         CDS       T01416                                 

Gene name
SRF
Definition
(RefSeq) serum response factor isoform X1
  KO
K04378  serum response factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04022  cGMP-PKG signaling pathway
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100436127 (SRF)
   04022 cGMP-PKG signaling pathway
    100436127 (SRF)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100436127 (SRF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100436127 (SRF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100436127 (SRF)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    100436127 (SRF)
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 100436127
NCBI-ProteinID: XP_002816959
Ensembl: ENSPPYG00000016633
UniProt: H2PJ46 A0A6D2XBV9
LinkDB
Position
6
AA seq 508 aa
MLPSQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDTAHSTKSE
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgttaccgagccaagctggggccgcggcggctctgggccggggctcggccctggggggc
agcctgaaccggaccccgacggggcggccgggcggcggcggcgggacacgcggggctaac
gggggccgggtccccgggaatggcgcggggctcgggcccggccgcctggagcgggaggct
gcggcagcggcggcaaccaccccggcgcccaccgcgggggccctctacagcggcagcgag
ggcgactcggagtcgggcgaggaggaggagctgggcgccgagcggcgcggcctgaagcgg
agcctgagcgagatggagatcggtatggtggtcggtgggcccgaggcgtcggcagcggcc
accgggggctacgggccggtgagcggcgcggtgagcggggccaagccgggtaagaagacc
cggggccgcgtgaagatcaagatggagttcatcgacaacaagctgcggcgctacacgacc
ttcagcaagaggaagacgggcatcatgaagaaggcctatgagctgtccacgctgacaggg
acacaggtgctgttgctggtggccagtgagaccggccatgtgtatacctttgccacccga
aaactgcagcccatgatcaccagtgagaccggcaaggcactgattcagacctgcctcaac
tcgccagactctccaccccgctcagaccccacaacagaccagagaatgagtgccactggc
tttgaagagacagatctcacctaccaggtgtcggagtctgacagcagtggggagaccaag
gacacactgaagccggcgttcacagtcaccaacctgccgggtacaacctccaccatccaa
acagcacctagcacctctaccaccatgcaagtcagcagcggcccctcctttcccatcacc
aactacctggcaccagtgtctgctagtgtcagccccagtgctgtcagcagtgccaatggg
actgtgctgaagagtacaggcagcggccctgtctcctctgggggccttatgcagctgcct
accagcttcaccctcatgcctggtggggcagtggcccagcaggtcccagtgcaggccatt
caagtgcaccaggccccacagcaagcgtctccctcccgtgacagcagcacagacctcacg
cagacctcctccagcgggacagtgacgctgcccgccaccatcatgacgtcatccgtgccc
acaactgtgggtggccacatgatgtaccctagcccgcatgcggtgatgtatgcccccacc
tcgggcctgggtgatggcagcctcaccgtgctgaatgccttctcccaggcaccatccacc
atgcaggtgtcacacagccaggtccaggagccaggtggcgtcccccaggtgttcctgaca
gcatcatctgggacagtgcagatccctgtttcagcagttcagctccaccagatggctgtg
atagggcagcaggctgggagcagcagcaacctcaccgagctacaggtggtgaacctggat
accgcccacagcaccaagagtgaatga

DBGET integrated database retrieval system