KEGG   Pongo abelii (Sumatran orangutan): 100436170
Entry
100436170         CDS       T01416                                 

Gene name
HMGA2
Definition
(RefSeq) high mobility group protein HMGI-C isoform X2
  KO
K09283  high mobility group AT-hook protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05202  Transcriptional misregulation in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100436170 (HMGA2)
   05206 MicroRNAs in cancer
    100436170 (HMGA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100436170 (HMGA2)
   03036 Chromosome and associated proteins [BR:pon03036]
    100436170 (HMGA2)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Other transcription factors
   HMGI(Y)
    100436170 (HMGA2)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    100436170 (HMGA2)
SSDB
Motif
Pfam: AT_hook DUF5681
Other DBs
NCBI-GeneID: 100436170
NCBI-ProteinID: XP_002823531
Ensembl: ENSPPYG00000004736
UniProt: A0A2J8W0T9
LinkDB
Position
12
AA seq 109 aa
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED
NT seq 330 nt   +upstreamnt  +downstreamnt
atgagcgcacgcggtgagggcgcggggcagccgtccacttcagcccagggacaacctgcc
gccccagcgcctcagaagagaggacgcggccgccccaggaagcagcagcaagaaccaacc
ggtgagccctctcctaagagacccaggggaagacctaaaggcagcaaaaacaagagtccc
tctaaagcagctcaaaagaaagcagaagccactggagaaaaacggccaagaggcagaccc
aggaaatggccacaacaagttgttcagaagaagcctgctcaggaggaaactgaagagaca
tcctcacaagagtctgccgaagaggactag

DBGET integrated database retrieval system