KEGG   Pongo abelii (Sumatran orangutan): 100436188
Entry
100436188         CDS       T01416                                 

Gene name
MCL1
Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1 isoform X1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04630  JAK-STAT signaling pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100436188 (MCL1)
   04151 PI3K-Akt signaling pathway
    100436188 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100436188 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100436188 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 100436188
NCBI-ProteinID: XP_002810320
Ensembl: ENSPPYG00000000894
UniProt: A0A6D2W6X2 H2N5Y9
LinkDB
Position
1
AA seq 350 aa
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLFFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgttcggcctcaaaagaaacgcggtaatcggactcaacctctactgtgggggggccggc
ttgggtgctggcagcggcggcgccacccctccgggagggcggcttttggctacggagaag
gaggcctcggcccggcgagagatagggggaggggaggccggcgcggtgattggcggaagc
gccggcgcaagccccccgtctaccctcacgccagactcccggagggtcgcgcggccgccg
cccattggcgccgaggtccccgacgtcaccgcgacccccgcgaggctgtttttcttcgcg
cccacccgccgcgcggcgccgcttgaggagatggaagccccggccgccgacgccatcatg
tcgcccgaagaggagctggacgggtacgagccggagcctctcgggaagcggccggctgtc
ctgcctctgctggagttggtcggggaatctggtaataacaccagtacggacgggtcacta
ccctcgacgccgccgccagcagaggaggaggaggacgagttgtaccggcagtcgctggag
attatctctcggtaccttcgggagcaggccaccggcgccaaggacacaaagccattgggc
aggtctggggccacctgcaggaaggctctggagaccttacgacgggttggggatggcgtg
cagcgcaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaa
gacgatgtgaaatcgttgtctcgagtgatggtccatgttttcagcgacggcgtaacaaac
tggggcaggattgtgactctcatttcttttggtgcctttgtggctaaacacttgaagacc
ataaaccaagaaagctgcatcgaaccattagcagaaagtatcacagacgttctcgtaagg
acaaaacgggactggctagttaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggacctagaaggaggcatcagaaatgtgctgctggcttttgcaggtgttgctgga
gtaggagctggtttggcatatctaataagatag

DBGET integrated database retrieval system