KEGG   Pongo abelii (Sumatran orangutan): 100436252
Entry
100436252         CDS       T01416                                 

Gene name
GJA1
Definition
(RefSeq) gap junction alpha-1 protein
  KO
K07372  gap junction alpha-1 protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04540  Gap junction
pon05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100436252 (GJA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100436252 (GJA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100436252 (GJA1)
Transporters [BR:pon02000]
 Other transporters
  Pores ion channels [TC:1]
   100436252 (GJA1)
SSDB
Motif
Pfam: Connexin Connexin43 Connexin40_C 7tm_1 Ammonium_transp
Other DBs
NCBI-GeneID: 100436252
NCBI-ProteinID: XP_002817351
Ensembl: ENSPPYG00000016974
UniProt: H2PK80
LinkDB
Position
6
AA seq 382 aa
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPG
CENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDG
ANVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFS
LSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRV
KGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN
YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD
QRPSSRASSRASSRPRPDDLEI
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggtgactggagcgccttaggcaaactccttgacaaggttcaagcctactcaactgct
ggagggaaggtgtggctgtcagtacttttcattttccgaatcctgctgctggggacagcg
gttgagtcagcctggggagatgagcagtctgcctttcgttgtaacactcagcaacctggt
tgtgaaaacgtctgctatgacaagtctttcccaatctctcatgtgcgcttctgggtcctg
cagatcatatttgtgtctgtacccacactcttgtacctggctcatgtgttctatgtgatg
cgaaaggaagagaaactgaacaagaaagaggaggaactcaaggttgcccaaactgatggt
gccaatgtggacatgcacttgaagcagattgagataaagaagttcaagtatggtattgaa
gagcatggtaaggtgaaaatgcgaggggggttgctgcgaacctacatcatcagtatcctc
ttcaagtctatctttgaggtggccttcttgctgatccagtggtacatctatggattcagc
ttgagtgctgtttacacttgcaaaagagatccctgcccacatcaggtagactgtttcctc
tctcgccccacggagaaaaccatcttcatcatcttcatgctggtggtgtccttggtgtcc
ctggccttgaatatcattgaactcttctatgttttcttcaagggcgttaaggatcgggtt
aagggaaagagcgacccttaccatgcgaccagtggcgcgctgagccccgccaaagactgt
gggtctcaaaaatatgcttatttcaatggctgctcctcaccaaccgctcccctctcgcct
atgtctcctcctgggtacaagctggttactggcgacagaaacaattcttcttgccgcaat
tacaacaagcaagcaagtgagcaaaactgggctaattacagtgcagaacaaaatcgaatg
gggcaggcgggaagcaccatctctaactcccatgcacagccttttgatttccccgatgat
aaccagaattctaaaaaactagctgctggacatgaattacagccactagccattgtggac
cagcgaccttcaagcagagccagcagtcgtgccagcagcagacctcggcctgatgacctg
gagatctag

KEGG   Pongo abelii (Sumatran orangutan): 100441866
Entry
100441866         CDS       T01416                                 

Gene name
GJD2
Definition
(RefSeq) gap junction delta-2 protein
  KO
K07373  gap junction delta-2 protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04540  Gap junction
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100441866 (GJD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100441866 (GJD2)
Transporters [BR:pon02000]
 Other transporters
  Pores ion channels [TC:1]
   100441866 (GJD2)
SSDB
Motif
Pfam: Connexin
Other DBs
NCBI-GeneID: 100441866
NCBI-ProteinID: XP_002825308
Ensembl: ENSPPYG00000006317
UniProt: H2NMR2 A0A663DG38
LinkDB
Position
15
AA seq 321 aa
MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP
GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP
PESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSG
LRTASKSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEV
ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSIYEIRNK
DLPRVSVPNFGRTQSSDSAYV
NT seq 966 nt   +upstreamnt  +downstreamnt
atgggggaatggaccatcttggagaggctgctagaagccgcggtgcagcagcactccact
atgatcgggaggatcctgttgactgtggtggtgatcttccggatcctcattgtggccatt
gtgggggagacggtgtacgatgatgagcagaccatgtttgtgtgcaacaccctgcagccc
ggctgtaaccaggcctgctatgaccgggccttccccatctcccacatacgttactgggtc
ttccagatcataatggtgtgtacccccagtctttgcttcatcacctactctgtgcaccag
tccgccaagcagcgagaacgccgctactctactgtcttcctagccctggacagagacccc
cctgagtccataggaggtcctggaggaactgggggtgggggcagtggtgggggcaaacga
gaagataagaagttgcaaaatgctattgtcaatggggtgctgcagaacacagagaacacc
agtaaggagacagagccagattgtttagaggttaaggagctgactccacacccatcaggg
ctacgcactgcatcaaaatccaagctcagaaggcaggaaggcatctcccgcttctacatt
atccaagtggtgttccgaaatgccctggaaattgggttcctggtgggccaatattttctc
tatggctttagtgtcccagggttgtatgagtgtaaccgctacccctgcatcaaggaggtg
gaatgttatgtgtcccggccaactgagaagactgtctttctagtgttcatgtttgctgta
agtggcatctgtgttgtgctcaacctggctgaactcaaccacctgggatggcgcaagatc
aagctggctgtgcgaggggctcaggccaagagaaagtcaatctatgagattcgtaacaag
gacctgccaagggtcagtgttcccaattttggcaggactcagtccagtgactctgcctat
gtgtga

DBGET integrated database retrieval system